Over 1 million tech questions and answers.

Infected With Trojan Clicker Win32 Tiny.h / Downloader Win32 Agent Bq / Spy Win32 Key Logger.aa/spy Win32 Green Screen / Html B...

Q: Infected With Trojan Clicker Win32 Tiny.h / Downloader Win32 Agent Bq / Spy Win32 Key Logger.aa/spy Win32 Green Screen / Html B...

Hi,Please help me in getting rid of the pop ups which keep coming up.trojan downloader win32 agent bqtrojan clicker win32 tiny htrojan spy win32 key logger.aatrojan spy win32 green screentrojan spy html bankfraud.dqHijakThis log file.Logfile of Trend Micro HijackThis v2.0.2Scan saved at 15:00:40, on 9/8/2008Platform: Windows XP SP2 (WinNT 5.01.2600)MSIE: Internet Explorer v7.00 (7.00.6000.16705)Boot mode: NormalRunning processes:C:\WINDOWS\System32\smss.exeC:\WINDOWS\system32\csrss.exeC:\WINDOWS\system32\winlogon.exeC:\WINDOWS\system32\services.exeC:\WINDOWS\system32\lsass.exeC:\WINDOWS\system32\svchost.exeC:\WINDOWS\system32\svchost.exeC:\WINDOWS\System32\svchost.exeC:\WINDOWS\system32\svchost.exeC:\WINDOWS\system32\svchost.exeC:\Program Files\Common Files\Symantec Shared\ccProxy.exeC:\Program Files\Common Files\Symantec Shared\ccSetMgr.exeC:\Program Files\Symantec Client Security\Symantec Client Firewall\ISSVC.exeC:\Program Files\Common Files\Symantec Shared\SNDSrvc.exeC:\Program Files\Common Files\Symantec Shared\SPBBC\SPBBCSvc.exeC:\Program Files\Common Files\Symantec Shared\ccEvtMgr.exeC:\WINDOWS\system32\spoolsv.exeC:\WINDOWS\Explorer.EXEC:\Program Files\Hewlett-Packard\HP Quick Launch Buttons\QlbCtrl.exeC:\Program Files\hpq\HP Wireless Assistant\HP Wireless Assistant.exeC:\Program Files\HP\QuickPlay\QPService.exeC:\Program Files\Synaptics\SynTP\SynTPEnh.exeC:\Program Files\Winamp\winampa.exeC:\Program Files\Common Files\Symantec Shared\ccApp.exeC:\Program Files\Hp\HP Software Update\HPWuSchd2.exeC:\Program Files\Java\j2re1.4.2_05\bin\jusched.exeC:\Program Files\Spyware Doctor\pctsTray.exeC:\Program Files\Common Files\Real\Update_OB\realsched.exeC:\PROGRA~1\Sony\SONICS~1\SsAAD.exeC:\PROGRA~1\Comodo\CBOClean\BOC427.exeC:\Program Files\Common Files\LightScribe\LightScribeControlPanel.exeC:\WINDOWS\system32\ctfmon.exeC:\PROGRA~1\WINDOW~4\MESSEN~1\msnmsgr.exeC:\PROGRA~1\Yahoo!\MESSEN~1\YAHOOM~1.EXEC:\Program Files\Common Files\Ahead\lib\NMBgMonitor.exeC:\Program Files\Google\GoogleToolbarNotifier\GoogleToolbarNotifier.exeC:\Program Files\Nokia\Nokia PC Suite 7\PCSuite.exeC:\Program Files\Nokia\Nokia PC Suite 7\PCSync2.exeC:\WINDOWS\system32\absdubov.exeC:\Program Files\WIDCOMM\Bluetooth Software\BTTray.exeC:\Program Files\Hewlett-Packard\HP Pavilion Webcam\tsnp2std.exeC:\Program Files\Sony\Sony Picture Utility\VolumeWatcher\SPUVolumeWatcher.exeC:\PROGRA~1\WIDCOMM\BLUETO~1\BTSTAC~1.EXEC:\Program Files\Common Files\Nokia\MPAPI\MPAPI3s.exeC:\Program Files\Comodo\CBOClean\BOCORE.exeC:\Program Files\WIDCOMM\Bluetooth Software\bin\btwdins.exeC:\Program Files\Symantec Client Security\Symantec AntiVirus\DefWatch.exeC:\Program Files\Google\Common\Google Updater\GoogleUpdaterService.exeC:\Program Files\Common Files\LightScribe\LSSrvc.exeC:\PROGRA~1\McAfee\MSC\mcmscsvc.exec:\PROGRA~1\COMMON~1\mcafee\mna\mcnasvc.exec:\PROGRA~1\COMMON~1\mcafee\mcproxy\mcproxy.exeC:\Program Files\McAfee\VirusScan\McShield.exeC:\Program Files\McAfee\MPF\MPFSrv.exeC:\Program Files\McAfee\MSK\MskSrver.exeC:\Program Files\Symantec Client Security\Symantec AntiVirus\SavRoam.exeC:\Program Files\Spyware Doctor\pctsAuxs.exeC:\Program Files\Spyware Doctor\pctsSvc.exec:\PROGRA~1\mcafee.com\agent\mcagent.exeC:\WINDOWS\system32\svchost.exeC:\Program Files\Symantec Client Security\Symantec Client Firewall\SymSPort.exeC:\WINDOWS\system32\wdfmgr.exeC:\Program Files\Hewlett-Packard\Shared\hpqwmiex.exeC:\Program Files\PC Connectivity Solution\ServiceLayer.exeC:\WINDOWS\system32\wbem\wmiprvse.exeC:\Program Files\PC Connectivity Solution\Transports\NclUSBSrv.exeC:\Program Files\PC Connectivity Solution\Transports\NclRSSrv.exeC:\WINDOWS\System32\alg.exeC:\Program Files\PC Connectivity Solution\Transports\NclMSBTSrv.exeC:\Program Files\PC Connectivity Solution\Transports\NclBCBTSrv.exeC:\PROGRA~1\hpq\Shared\HPQTOA~1.EXEC:\Program Files\Microsoft Office\OFFICE11\OUTLOOK.EXEC:\Program Files\Microsoft Office\OFFICE11\WINWORD.EXEC:\Program Files\Internet Explorer\iexplore.exeC:\Program Files\Common Files\Microsoft Shared\Windows Live\WLLoginProxy.exeC:\Program Files\Spybot - Search & Destroy\SpybotSD.exeC:\PROGRA~1\McAfee\VIRUSS~1\mcsysmon.exeC:\Program Files\Trend Micro\HijackThis\HijackThis.exeC:\WINDOWS\system32\wbem\wmiprvse.exeR0 - HKCU\Software\Microsoft\Internet Explorer\Main,Start Page = in.msn.com/R1 - HKLM\Software\Microsoft\Internet Explorer\Main,Default_Page_URL = http://go.microsoft.com/fwlink/?LinkId=69157R1" target="_blank" class="wLink">http://go.microsoft.com/fwlink/?LinkId=69157R1 - HKLM\Software\Microsoft\Internet Explorer\Main,Default_Search_URL = http://go.microsoft.com/fwlink/?LinkId=54896R1 - HKLM\Software\Microsoft\Internet Explorer\Main,Search Page = http://go.microsoft.com/fwlink/?LinkId=54896R0 - HKLM\Software\Microsoft\Internet Explorer\Main,Start Page = http://go.microsoft.com/fwlink/?LinkId=69157R1 - HKCU\Software\Microsoft\Windows\CurrentVersion\Internet Settings,ProxyServer = 10.1.65.11:80R3 - URLSearchHook: Yahoo! Toolbar - {EF99BD32-C1FB-11D2-892F-0090271D4F88} - C:\PROGRA~1\Yahoo!\Companion\Installs\cpn\yt.dllO1 - Hosts: 62.189.6.78 _sip._tls.sip1.callserve.comO1 - Hosts: 62.189.6.78 _sip._ssl.sip1.callserve.comO1 - Hosts: 62.189.6.79 _sip._tls.sip2.callserve.comO1 - Hosts: 62.189.6.79 _sip._ssl.sip2.callserve.comO1 - Hosts: 62.189.6.85 _sip._tls.sip5.phoneserve.comO1 - Hosts: 62.189.6.85 _sip._ssl.sip5.phoneserve.comO1 - Hosts: 62.189.6.84 _sip._tls.abcd.winnerip.comO1 - Hosts: 62.189.6.84 _sip._ssl.abcd.winnerip.comO1 - Hosts: 62.189.6.81 _sip._tls.efgh.winnerip.comO1 - Hosts: 62.189.6.81 _sip._ssl.efgh.winnerip.comO1 - Hosts: 62.189.6.83 _sip._tls.ijkl.winnerip.comO1 - Hosts: 62.189.6.83 _sip._ssl.ijkl.winnerip.comO2 - BHO: &Yahoo! Toolbar Helper - {02478D38-C3F9-4efb-9B51-7695ECA05670} - C:\PROGRA~1\Yahoo!\Companion\Installs\cpn\yt.dllO2 - BHO: Adobe PDF Reader Link Helper - {06849E9F-C8D7-4D59-B87D-784B7D6BE0B3} - C:\Program Files\Common Files\Adobe\Acrobat\ActiveX\AcroIEHelper.dllO2 - BHO: Skype add-on (mastermind) - {22BF413B-C6D2-4d91-82A9-A0F997BA588C} - C:\Program Files\Skype\Toolbars\Internet Explorer\SkypeIEPlugin.dllO2 - BHO: RealPlayer Download and Record Plugin for Internet Explorer - {3049C3E9-B461-4BC5-8870-4C09146192CA} - C:\Program Files\Real\RealPlayer\rpbrowserrecordplugin.dllO2 - BHO: McAntiPhishingBHO - {377C180E-6F0E-4D4C-980F-F45BD3D40CF4} - c:\PROGRA~1\mcafee\msk\mcapbho.dllO2 - BHO: Spybot-S&D IE Protection - {53707962-6F74-2D53-2644-206D7942484F} - C:\PROGRA~1\SPYBOT~1\SDHelper.dllO2 - BHO: Yahoo! IE Services Button - {5BAB4B5B-68BC-4B02-94D6-2FC0DE4A7897} - C:\Program Files\Yahoo!\Common\yiesrvc.dllO2 - BHO: scriptproxy - {7DB2D5A0-7241-4E79-B68D-6309F01C5231} - C:\Program Files\McAfee\VirusScan\scriptsn.dllO2 - BHO: (no name) - {7E853D72-626A-48EC-A868-BA8D5E23E045} - (no file)O2 - BHO: Windows Live Sign-in Helper - {9030D464-4C02-4ABF-8ECC-5164760863C6} - C:\Program Files\Common Files\Microsoft Shared\Windows Live\WindowsLiveLogin.dllO2 - BHO: Google Toolbar Helper - {AA58ED58-01DD-4d91-8333-CF10577473F7} - c:\program files\google\googletoolbar1.dllO2 - BHO: Google Toolbar Notifier BHO - {AF69DE43-7D58-4638-B6FA-CE66B5AD205D} - C:\Program Files\Google\GoogleToolbarNotifier\3.0.1225.9868\swg.dllO3 - Toolbar: &Google - {2318C2B1-4965-11d4-9B18-009027A5CD4F} - c:\program files\google\googletoolbar1.dllO3 - Toolbar: Yahoo! Toolbar - {EF99BD32-C1FB-11D2-892F-0090271D4F88} - C:\PROGRA~1\Yahoo!\Companion\Installs\cpn\yt.dllO4 - HKLM\..\Run: [Cpqset] C:\Program Files\HPQ\Default Settings\cpqset.exeO4 - HKLM\..\Run: [QlbCtrl.exe] C:\Program Files\Hewlett-Packard\HP Quick Launch Buttons\QlbCtrl.exe /StartO4 - HKLM\..\Run: [NvCplDaemon] RUNDLL32.EXE C:\WINDOWS\system32\NvCpl.dll,NvStartupO4 - HKLM\..\Run: [hpWirelessAssistant] C:\Program Files\hpq\HP Wireless Assistant\HP Wireless Assistant.exeO4 - HKLM\..\Run: [QPService] "C:\Program Files\HP\QuickPlay\QPService.exe"O4 - HKLM\..\Run: [SynTPEnh] C:\Program Files\Synaptics\SynTP\SynTPEnh.exeO4 - HKLM\..\Run: [NeroFilterCheck] C:\WINDOWS\system32\NeroCheck.exeO4 - HKLM\..\Run: [WinampAgent] C:\Program Files\Winamp\winampa.exeO4 - HKLM\..\Run: [ccApp] "C:\Program Files\Common Files\Symantec Shared\ccApp.exe"O4 - HKLM\..\Run: [vptray] C:\PROGRA~1\SYMANT~1\SYMANT~2\VPTray.exeO4 - HKLM\..\Run: [HP Software Update] C:\Program Files\Hp\HP Software Update\HPWuSchd2.exeO4 - HKLM\..\Run: [googletalk] C:\Program Files\Google\Google Talk\googletalk.exe /autostartO4 - HKLM\..\Run: [McENUI] C:\PROGRA~1\McAfee\MHN\McENUI.exe /hideO4 - HKLM\..\Run: [Adobe Reader Speed Launcher] "C:\Program Files\Adobe\Reader 8.0\Reader\Reader_sl.exe"O4 - HKLM\..\Run: [SunJavaUpdateSched] "C:\Program Files\Java\j2re1.4.2_05\bin\jusched.exe"O4 - HKLM\..\Run: [ISTray] "C:\Program Files\Spyware Doctor\pctsTray.exe"O4 - HKLM\..\Run: [TkBellExe] "C:\Program Files\Common Files\Real\Update_OB\realsched.exe" -osbootO4 - HKLM\..\Run: [SsAAD.exe] C:\PROGRA~1\Sony\SONICS~1\SsAAD.exeO4 - HKLM\..\Run: [BOC-427] C:\PROGRA~1\Comodo\CBOClean\BOC427.exeO4 - HKLM\..\Run: [TrojanScanner] C:\Program Files\Trojan Remover\Trjscan.exe /bootO4 - HKLM\..\Run: [THGuard] "C:\Program Files\TrojanHunter 5.0\THGuard.exe"O4 - HKCU\..\Run: [LightScribe Control Panel] C:\Program Files\Common Files\LightScribe\LightScribeControlPanel.exe -hiddenO4 - HKCU\..\Run: [ctfmon.exe] C:\WINDOWS\system32\ctfmon.exeO4 - HKCU\..\Run: [MsnMsgr] "C:\PROGRA~1\WINDOW~4\MESSEN~1\msnmsgr.exe" /backgroundO4 - HKCU\..\Run: [Yahoo! Pager] "C:\PROGRA~1\Yahoo!\MESSEN~1\YAHOOM~1.EXE" -quietO4 - HKCU\..\Run: [BgMonitor_{79662E04-7C6C-4d9f-84C7-88D8A56B10AA}] "C:\Program Files\Common Files\Ahead\lib\NMBgMonitor.exe"O4 - HKCU\..\Run: [swg] C:\Program Files\Google\GoogleToolbarNotifier\GoogleToolbarNotifier.exeO4 - HKCU\..\Run: [PC Suite Tray] "C:\Program Files\Nokia\Nokia PC Suite 7\PCSuite.exe" -onlytrayO4 - HKCU\..\Run: [Nokia.PCSync] "C:\Program Files\Nokia\Nokia PC Suite 7\PCSync2.exe" /NoDialogO4 - HKCU\..\Run: [comadmen] C:\WINDOWS\system32\absdubov.exeO4 - HKCU\..\Run: [SpybotSD TeaTimer] C:\Program Files\Spybot - Search & Destroy\TeaTimer.exeO4 - Startup: Picture Motion Browser Media Check Tool.lnk = C:\Program Files\Sony\Sony Picture Utility\VolumeWatcher\SPUVolumeWatcher.exeO4 - Global Startup: Bluetooth.lnk = ?O4 - Global Startup: HP Pavilion Webcam Tray Icon.lnk = ?O9 - Extra button: (no name) - {08B0E5C0-4FCB-11CF-AAA5-00401C608501} - C:\Program Files\Java\j2re1.4.2_05\bin\npjpi142_05.dllO9 - Extra 'Tools' menuitem: Sun Java Console - {08B0E5C0-4FCB-11CF-AAA5-00401C608501} - C:\Program Files\Java\j2re1.4.2_05\bin\npjpi142_05.dllO9 - Extra button: Yahoo! Services - {5BAB4B5B-68BC-4B02-94D6-2FC0DE4A7897} - C:\Program Files\Yahoo!\Common\yiesrvc.dllO9 - Extra button: Skype - {77BF5300-1474-4EC7-9980-D32B190E9B07} - C:\Program Files\Skype\Toolbars\Internet Explorer\SkypeIEPlugin.dllO9 - Extra button: Research - {92780B25-18CC-41C8-B9BE-3C9C571A8263} - C:\PROGRA~1\MICROS~2\OFFICE11\REFIEBAR.DLLO9 - Extra button: (no name) - {DFB852A3-47F8-48C4-A200-58CAB36FD2A2} - C:\PROGRA~1\SPYBOT~1\SDHelper.dllO9 - Extra 'Tools' menuitem: Spybot - Search & Destroy Configuration - {DFB852A3-47F8-48C4-A200-58CAB36FD2A2} - C:\PROGRA~1\SPYBOT~1\SDHelper.dllO9 - Extra button: Yahoo! Messenger - {E5D12C4E-7B4F-11D3-B5C9-0050045C3C96} - C:\PROGRA~1\Yahoo!\MESSEN~1\YPager.exe (file missing)O9 - Extra 'Tools' menuitem: Yahoo! Messenger - {E5D12C4E-7B4F-11D3-B5C9-0050045C3C96} - C:\PROGRA~1\Yahoo!\MESSEN~1\YPager.exe (file missing)O9 - Extra button: Messenger - {FB5F1910-F110-11d2-BB9E-00C04F795683} - C:\Program Files\Messenger\msmsgs.exeO9 - Extra 'Tools' menuitem: Windows Messenger - {FB5F1910-F110-11d2-BB9E-00C04F795683} - C:\Program Files\Messenger\msmsgs.exeO16 - DPF: {30528230-99f7-4bb4-88d8-fa1d4f56a2ab} (Installation Support) - C:\Program Files\Yahoo!\Common\Yinsthelper.dllO16 - DPF: {3EA4FA88-E0BE-419A-A732-9B79B87A6ED0} (CTVUAxCtrl Object) - http://dl.tvunetworks.com/TVUAx.cabO16 - DPF: {6414512B-B978-451D-A0D8-FCFDF33E833C} (WUWebControl Class) - http://update.microsoft.com/windowsupdate/...b?1208692624171O16 - DPF: {6E32070A-766D-4EE6-879C-DC1FA91D2FC3} (MUWebControl Class) - http://www.update.microsoft.com/microsoftu...b?1208751853281O16 - DPF: {9D614E8E-03AA-11D3-90FC-0040C7157029} (PDMSInstallerCtl Class) - http://www.pakdata.com/download/PDMSInstaller.cabO16 - DPF: {CAAE28D1-ADCC-11D1-BD4D-004845401881} (Urdu98 Control) - http://www.pakdata.com/download/urduplugin.cabO16 - DPF: {D27CDB6E-AE6D-11CF-96B8-444553540000} (Shockwave Flash Object) - http://fpdownload2.macromedia.com/get/shoc...ash/swflash.cabO18 - Protocol: skype4com - {FFC8B962-9B40-4DFF-9458-1830C7DD7F5D} - C:\PROGRA~1\COMMON~1\Skype\SKYPE4~1.DLLO18 - Protocol: x-owacid - {0215258F-F0A8-49DE-BF1B-0FF02EDA8807} - C:\Program Files\Microsoft\Outlook Web Access SMIME Client\mimectl.dllO23 - Service: BOCore - COMODO - C:\Program Files\Comodo\CBOClean\BOCORE.exeO23 - Service: Bluetooth Service (btwdins) - Broadcom Corporation. - C:\Program Files\WIDCOMM\Bluetooth Software\bin\btwdins.exeO23 - Service: Symantec Event Manager (ccEvtMgr) - Symantec Corporation - C:\Program Files\Common Files\Symantec Shared\ccEvtMgr.exeO23 - Service: Symantec Network Proxy (ccProxy) - Symantec Corporation - C:\Program Files\Common Files\Symantec Shared\ccProxy.exeO23 - Service: Symantec Password Validation (ccPwdSvc) - Symantec Corporation - C:\Program Files\Common Files\Symantec Shared\ccPwdSvc.exeO23 - Service: Symantec Settings Manager (ccSetMgr) - Symantec Corporation - C:\Program Files\Common Files\Symantec Shared\ccSetMgr.exeO23 - Service: Symantec AntiVirus Definition Watcher (DefWatch) - Symantec Corporation - C:\Program Files\Symantec Client Security\Symantec AntiVirus\DefWatch.exeO23 - Service: Google Updater Service (gusvc) - Google - C:\Program Files\Google\Common\Google Updater\GoogleUpdaterService.exeO23 - Service: hpqwmiex - Hewlett-Packard Development Company, L.P. - C:\Program Files\Hewlett-Packard\Shared\hpqwmiex.exeO23 - Service: IS Service (ISSVC) - Symantec Corporation - C:\Program Files\Symantec Client Security\Symantec Client Firewall\ISSVC.exeO23 - Service: LightScribeService Direct Disc Labeling Service (LightScribeService) - Hewlett-Packard Company - C:\Program Files\Common Files\LightScribe\LSSrvc.exeO23 - Service: McAfee Services (mcmscsvc) - McAfee, Inc. - C:\PROGRA~1\McAfee\MSC\mcmscsvc.exeO23 - Service: McAfee Network Agent (McNASvc) - McAfee, Inc. - c:\PROGRA~1\COMMON~1\mcafee\mna\mcnasvc.exeO23 - Service: McAfee Scanner (McODS) - McAfee, Inc. - C:\PROGRA~1\McAfee\VIRUSS~1\mcods.exeO23 - Service: McAfee Proxy Service (McProxy) - McAfee, Inc. - c:\PROGRA~1\COMMON~1\mcafee\mcproxy\mcproxy.exeO23 - Service: McAfee Real-time Scanner (McShield) - McAfee, Inc. - C:\Program Files\McAfee\VirusScan\McShield.exeO23 - Service: McAfee SystemGuards (McSysmon) - McAfee, Inc. - C:\PROGRA~1\McAfee\VIRUSS~1\mcsysmon.exeO23 - Service: McAfee Personal Firewall Service (MpfService) - McAfee, Inc. - C:\Program Files\McAfee\MPF\MPFSrv.exeO23 - Service: MSCSPTISRV - Sony Corporation - C:\Program Files\Common Files\Sony Shared\AVLib\MSCSPTISRV.exeO23 - Service: McAfee Anti-Spam Service (MSK80Service) - McAfee, Inc. - C:\Program Files\McAfee\MSK\MskSrver.exeO23 - Service: NVIDIA Display Driver Service (NVSvc) - NVIDIA Corporation - C:\WINDOWS\system32\nvsvc32.exeO23 - Service: PACSPTISVR - Sony Corporation - C:\Program Files\Common Files\Sony Shared\AVLib\PACSPTISVR.exeO23 - Service: SAVRoam (SavRoam) - symantec - C:\Program Files\Symantec Client Security\Symantec AntiVirus\SavRoam.exeO23 - Service: PC Tools Auxiliary Service (sdAuxService) - PC Tools - C:\Program Files\Spyware Doctor\pctsAuxs.exeO23 - Service: PC Tools Security Service (sdCoreService) - PC Tools - C:\Program Files\Spyware Doctor\pctsSvc.exeO23 - Service: ServiceLayer - Nokia. - C:\Program Files\PC Connectivity Solution\ServiceLayer.exeO23 - Service: Symantec Network Drivers Service (SNDSrvc) - Symantec Corporation - C:\Program Files\Common Files\Symantec Shared\SNDSrvc.exeO23 - Service: Symantec SPBBCSvc (SPBBCSvc) - Symantec Corporation - C:\Program Files\Common Files\Symantec Shared\SPBBC\SPBBCSvc.exeO23 - Service: Sony SPTI Service (SPTISRV) - Sony Corporation - C:\Program Files\Common Files\Sony Shared\AVLib\SPTISRV.exeO23 - Service: SonicStage SCSI Service (SSScsiSV) - Sony Corporation - C:\Program Files\Common Files\Sony Shared\AVLib\SSScsiSV.exeO23 - Service: Symantec AntiVirus - Symantec Corporation - C:\Program Files\Symantec Client Security\Symantec AntiVirus\Rtvscan.exeO23 - Service: Symantec SecurePort (SymSecurePort) - Symantec Corporation - C:\Program Files\Symantec Client Security\Symantec Client Firewall\SymSPort.exeO23 - Service: TuneUp WinStyler Theme Service (TUWinStylerThemeSvc) - TuneUp Software GmbH - C:\Program Files\TuneUp Utilities 2006\WinStylerThemeSvc.exe--End of file - 17102 bytes

RELEVANCY SCORE 200
Preferred Solution: Infected With Trojan Clicker Win32 Tiny.h / Downloader Win32 Agent Bq / Spy Win32 Key Logger.aa/spy Win32 Green Screen / Html B...

I recommend downloading and running DAP. It can help sort out any driver and firmware related issues on your system

It's worked out well for many of us in the past.

You can download it direct from this link http://downloaddap.org. (This link will open the download page of DAP so you can save a copy to your computer.)

A: Infected With Trojan Clicker Win32 Tiny.h / Downloader Win32 Agent Bq / Spy Win32 Key Logger.aa/spy Win32 Green Screen / Html B...

Sorry for the delay. If you are still having problems please post a brand new HijackThis log as a reply to this topic. Before posting the log, please make sure you follow all the steps found in this topic:Preparation Guide For Use Before Posting A Hijackthis LogPlease also post the problems you are having.

Read other 1 answers
RELEVANCY SCORE 244.8

Hi,It seems that I have trojan activity on my home pc.I am running Vista and when I log in to my user profile I get a blue desktop with a box saying 'Warning! Spyware detected on your computer! Install an antivirus or spyware remover to clean your computer'I have tried a few malware removal programs, Malwarebytes, CCleaner, Adaware and ran virus scans in an attemp to try and remove it myself without bothering you guys but I just can't shift it, so I'm hoping you may have the time to help?What I have noticed is that I only get these warnings when I am logged into my user profile, not as administrator or as another user on the pc. I also get no warnings when running in safe mode.I run Avast and that brings up a warning soon after the blue desktop comes up that points to infection with C:\Users\Guy\AppsData\Local\Temp\tt991.tmp.vbs. The numbers/letters after the tt (in this case 991) change each time I log in. It also states Malware Name: VBS:Malware-gen, Malware Type: Virus/Worm, VBS verison 080805-0,08/05/08 which I try and delete from the warning box.I then am greeted with a windows script host message box that will say the above file (tt991.tmp.vbs) failed (Access Denied).I also regularly get Windows security alert message boxes come up on the screen saying that Windows Firewall has detected activity of harmfull software with mention of one of many trojans. These have been:Trojan-Clicker.Win32.Tiny.hTrojan-Downloader.Win32.Agent.bqTrojan... Read more

A:Vbs:malware-gen - Trojan-clicker.win32.tiny.h, Trojan-downloader.win32.agent.bq, Trojan-spy.win32.keylogger.aa

Hi,I am hoping you can help me.My computer keeps telling me it is infected with spyware/malware. I get a blue desktop on startup with regular warnings saying the computer is infected with:Trojan-Clicker.Win32.Tiny.hTrojan-Downloader.Win32.Agent.bqTrojan-Spy.Win32.KeyLogger.aaTrojan-Spy.Win32.GreenScreenTrojan-Spy.HTML.Bankfraud.dqStrange thing is that these only show up when I log in to my user account. If I log in as administrator, another user or as any user in safe mode I get no warnings and nothing shows up on scans.The pop up warings direct me to this site: www.antispyware-review.info/?wmid=46638&pwebmid=uWfLn0pimL&a= which is Smartsoft reviews to buy PC Antispy or PC Clean pro.Malwarebytes scan picks up Fake.Dropped.Malware, Malware.Trace, Trojan.FakeAlert and Hijack.Wallpaper and even if I remove these and restart the PC they come back.A spybot scan pointed to 2 entries of VirtumondeI'll attach the latest HJT log, Malwarebytes log and Spybot logs in case you need them. Please help me with this, I cant seem to shift it Logfile of Trend Micro HijackThis v2.0.2Scan saved at 11:54:34 AM, on 8/7/2008Platform: Windows Vista SP1 (WinNT 6.00.1905)MSIE: Internet Explorer v7.00 (7.00.6001.18000)Boot mode: NormalRunning processes:C:\Windows\system32\taskeng.exeC:\Windows\system32\Dwm.exeC:\Windows\Explorer.EXEC:\Program Files\Windows Defender\MSASCui.exeC:\Windows\RtHDVCpl.exeC:\Program Files\Ado... Read more

Read other 5 answers
RELEVANCY SCORE 220.8

Hi, here is my problem. Everytime I download some movies or other things by opening my computer overnight, it must pop out a error window said:-C:\Documents and setting\KkianN\Desktop is not accessible.Not enough quota is available to process this command.The icons only left on my screen were My computer,my network places and Internet explorer. When I refresh my computer, it came out the same message again.(this problem was occured when I opened my computer overnight by using Thunder5 this software to download things)When I tried to shut down, a message said You do not have permission to shut down this computer.When I tried to use windows task manager to shut down,once i click Ctrl+Alt+Del, an application error message came out said:-This application failed to initialize properly(0xc000012d). Click on OK to terminate the application.Then I just can reset my computer.Actually I have posted in BleepingComputer.com > Security > Am I infected? What do I do? there.Then I followed the instruction in "Preparation Guide For Use Before Posting A Hijackthis Log". Unfortunately,i can't finish all the steps there. For step 4, I can't remove win32.generic.pws,win32.trojan.psw.delf and Win32.trojan.pws.onlinegames by using Ad-aware 2007. While scanning by using spybot,it stuck while scanning.After that suddenly pop out a window said:-Spybot-Search and destroy has detected an important registry entry that has been changed. Category: System Startup global entr... Read more

A:Infected With Dropper.agent,logger.pcap.a,win32.generic.pws,win32.trojan.psw.delf And Win32.trojan.pws.onlinegames

Hello, I had reformatted my computer since it could not open and stuck in the welcome window few days ago. So, now my computer is alright..thanks for viewing and trying to help me to fix the problem.

Read other 1 answers
RELEVANCY SCORE 207.2

KASPERSKY ONLINE SCANNER 7 REPORTSaturday, November 29, 2008Operating System: Microsoft Windows XP Professional Service Pack 3 (build 2600)Kaspersky Online Scanner 7 version: 7.0.25.0Program database last update: Friday, November 28, 2008 18:35:48Records in database: 1424124Scan settingsScan using the following database extendedScan archives yesScan mail databases yesScan area My ComputerC:\D:\E:\F:\Scan statisticsFiles scanned 94300Threat name 4Infected objects 4Suspicious objects 0Duration of the scan 02:45:29File name Threat name Threats countC:\Documents and Settings\All Users\Application Data\FreeApp.exe Infected: Trojan.Win32.Agent.arng 1 C:\Qoobox\Quarantine\C\Program Files\tinyproxy\tinyproxy.exe.vir Infected: Trojan-Proxy.Win32.Agent.bcw 1 C:\RECYCLER\S-1-5-21-1482476501-1644491937-682003330-1013\winse32.exe Infected: IRC-Worm.Win32.Small.x 1 C:\WINDOWS\bolivar24.exe Infected: Backdoor.Win32.Agent.ubx 1 The selected area was scanned.----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Logfile of random's system information tool 1.04 (written by random/random... Read more

A:Infected: Trojan.Win32.Agent.arng, Trojan-Proxy.Win32.Agent.bcw, IRC-Worm.Win32.Small.x, Backdoor.Win32.Agent.ubx

Hello and to Bleeping ComputerWe apologize for the delay in responding to your request for help. Here at Bleeping Computer we get overwhelmed at times, and we are trying our best to keep up. Please note that your topic was not intentionally overlooked. Our mission is to help everyone in need, but sometimes it takes just a little longer to get to every request for help.If you have since resolved the original problem you were having, we would appreciate you letting us know. If not please perform the following steps below so we can have a look at the current condition of your machine. If you have not done so, include a description of your problem, along with any steps you may have performed so far.Upon completing the steps below a staff member will review and take the steps necessary with you to get your machine back in working order clean and free of malware.Thanks and again sorry for the delay.We need to see some information about what is happening in your machine. Please perform the following scan:Download DDS by sUBs from one of the following links. Save it to your desktop.DDS.comDDS.scrDDS.pifDouble click on the DDS icon, allow it to run.A small box will open, with an explaination about the tool. No input is needed, the scan is running.Notepad will open with the results, click no to the Optional_ScanFollow the instructions that pop up for posting the results.Close the program window, and delete the program from your desktop.Please note: You may have to disable any scr... Read more

Read other 4 answers
RELEVANCY SCORE 204

My Avast antivirus recently started detecting a whole host of viruses. I ran a thorough scan of all files and deleted every infected file until the scanner turned up a hit in the operating memory. It then suggested I run a boot sector scan - I did so. Upon rebooting Avast started detecting more viruses. This time I rebooted into Safe Mode and ran the scanner there, deleting everything I found. Apparently one of the files I deleted was important, because after that my computer Blue-Screened during boot-up and I had to do a system restore to a save point from a few days ago (before the virus was contracted). Since then the virus has continued to crop up, and I haven't the foggiest notion of how to get rid of it.

The title is a list of the virus descriptions that my Avast scanner gave me. I ran all the programs the walkthrough on this site instructed me to, but the RootRepeal program crashed and generated an error message and crash report, both attached (error message in .png image format - I took a screenshot of it).

Thanks for your help!

__________________________________________________________________________________
DDS (Ver_09-12-01.01) - NTFSx86
Run by Bryan at 18:56:06.09 on Wed 12/02/2009
Internet Explorer: 8.0.7600.16385 BrowserJavaVersion: 1.6.0_17
Microsoft Windows 7 Home Premium 6.1.7600.0.1252.1.1033.18.3070.1546 [GMT -5:00]
============== Running Processes ===============

C:\Windows\system32\wininit.exe
C:\Windows\system32&... Read more

A:Infected with js: downloader-FT Win32:Banload-GLR Win32:Malware-gen Win32:Refpron-AW Win32:Rootkit-gen Win32:VB-NWC

Hello and welcome to Bleeping ComputerWe apologize for the delay in responding to your request for help. Here at Bleeping Computer we get overwhelmed at times, and we are trying our best to keep up. Please note that your topic was not intentionally overlooked. Our mission is to help everyone in need, but sometimes it takes just a little longer to get to every request for help. No one is ignored here.If you have since resolved the original problem you were having, we would appreciate you letting us know. If not please perform the following steps below so we can have a look at the current condition of your machine. If you have not done so, include a clear description of the problems you're having, along with any steps you may have performed so far.Upon completing the steps below another staff member will review and take the steps necessary with you to get your machine back in working order clean and free of malware.If you have already posted a DDS log, please do so again, as your situation may have changed.Use the 'Add Reply' and add the new log to this thread.Thanks and again sorry for the delay.We need to see some information about what is happening in your machine. Please perform the following scan:Download DDS by sUBs from one of the following links. Save it to your desktop.DDS.scrDDS.pifDouble click on the DDS icon, allow it to run.A small box will open, with an explaination about the tool. No input is needed, the scan is running.Notepad will open with the results.Foll... Read more

Read other 3 answers
RELEVANCY SCORE 203.2

Hi, as I've seen a post earlier about this problem, I wanted to post to inquire about the same problem I have, which the "trojan-Downloader.Win32.Agent Variant" warning shows up when I try to open World of Warcraft, I've used Norton Anti Virus to scan but for some reason I found nothing.

As in the previous post it mentioned downloading hijickthis and posting the findings..I was wondering if anyone could assist me with this and the steps... much appreciated.

Regards,
Nick
 

A:Trojan-Downloader.Win32.Agent Variantder-win32-agent-variant.html

Here is the hijackthis log as follows, please assit on the next steps. thanks
Logfile of HijackThis v1.99.1
Scan saved at 1:44:31 AM, on 5/16/2007
Platform: Windows XP SP2 (WinNT 5.01.2600)
MSIE: Internet Explorer v6.00 SP2 (6.00.2900.2180)

Running processes:
C:\WINDOWS\System32\smss.exe
C:\WINDOWS\system32\csrss.exe
C:\WINDOWS\system32\winlogon.exe
C:\WINDOWS\system32\services.exe
C:\WINDOWS\system32\lsass.exe
C:\Program Files\Common Files\Virtual Token\vtserver.exe
C:\WINDOWS\system32\ibmpmsvc.exe
C:\WINDOWS\system32\Ati2evxx.exe
C:\WINDOWS\system32\svchost.exe
C:\WINDOWS\system32\svchost.exe
C:\WINDOWS\System32\svchost.exe
C:\Program Files\Intel\Wireless\Bin\EvtEng.exe
C:\Program Files\Intel\Wireless\Bin\S24EvMon.exe
C:\WINDOWS\system32\svchost.exe
C:\WINDOWS\system32\svchost.exe
C:\Program Files\Common Files\Symantec Shared\ccEvtMgr.exe
C:\WINDOWS\system32\spoolsv.exe
c:\program files\common files\logishrd\lvmvfm\LVPrcSrv.exe
C:\Program Files\ThinkPad\Bluetooth Software\bin\btwdins.exe
C:\Program Files\IBM\IBM Rapid Restore Ultra\rrpcsb.exe
C:\Program Files\Norton AntiVirus\navapsvc.exe
C:\WINDOWS\System32\QCONSVC.EXE
C:\Program Files\Intel\Wireless\Bin\RegSrvc.exe
C:\Program Files\Analog Devices\SoundMAX\SMAgent.exe
C:\WINDOWS\system32\svchost.exe
C:\WINDOWS\System32\TPHDEXLG.EXE
C:\WINDOWS\system32\TpKmpSVC.exe
C:\WINDOWS\system32\wdfmgr.exe
C:\WINDOWS\System32\alg.exe
C:\WINDOWS\system32\Ati2evxx.exe
C:\WINDOWS\system32\wscntfy.exe
C:\WINDOWS\Explorer.EXE
C:\Program... Read more

Read other 3 answers
RELEVANCY SCORE 196.8

I have followed the 5 step rule with no luck and have searched the threads i am acualy a hardware guy and not up on the maleware viri so maybe some pitty here here is my HJTL

Logfile of HijackThis v1.99.1
Scan saved at 10:55:46 AM, on 2/1/2007
Windows XP SP2 (WinNT 5.01.2600)
MSIE: Internet Explorer v6.00 (6.00.2600.0000)

Running processes:
C:\WINDOWS\System32\smss.exe
C:\WINDOWS\system32\winlogon.exe
C:\WINDOWS\system32\services.exe
C:\WINDOWS\system32\lsass.exe
C:\WINDOWS\system32\svchost.exe
C:\WINDOWS\System32\svchost.exe
C:\WINDOWS\system32\spoolsv.exe
C:\WINDOWS\System32\nvsvc32.exe
C:\WINDOWS\system32\pctspk.exe
C:\WINDOWS\System32\svchost.exe
C:\WINDOWS\system32\winlogon.exe
C:\WINDOWS\Explorer.EXE
C:\Program Files\Google\GoogleToolbarNotifier\1.2.908.5008\GoogleToolbarNotifier.exe
C:\Program Files\PeoplePC\ISP6230\Browser\Bartshel.exe
C:\Program Files\PeoplePC\ISP6230\Browser\Bartshel.exe
C:\PROGRA~1\PeoplePC\ISP6230\Browser\PPShared.exe
C:\Program Files\PeoplePC Accelerated\PeoplePC.exe
C:\Documents and Settings\stacy\Desktop\hijackthis\HijackThis.exe

R1 - HKCU\Software\Microsoft\Windows\CurrentVersion\Internet Settings,ProxyServer = http=localhost:8080
O1 - Hosts: 12.129.205.209 search.netscape.com12.129.205.209 sitefinder.verisign.com
O2 - BHO: DriveLetterAccess - {5CA3D70E-1895-11CF-8E15-001234567890} - C:\WINDOWS\system32\dla\tfswshx.dll
O2 - BHO: SSVHelper Class - {761497BB-D6F0-462C-B6EB-D4DAF1D92D43} - C:\Program Files\Java\... Read more

A:Help please 3 trojans present Win32.Qhost.f-Win32.Dialer.mw-Clicker.Win32.Agent.ac

Hi scubbadoo32,

Welcome to Tech Support Forum!

I apologize for the delay getting to your log. The helpers here are all volunteers and we have been very busy here lately. If you are still having malware problems, I will be glad to help.

OK, here?s what we do first.


Please run HijackThis and click "Scan". Place a check (tick) next to the following entries (if present):

O1 - Hosts: 12.129.205.209 search.netscape.com12.129.205.209 sitefinder.verisign.com
O15 - Trusted Zone: http://secure.gestrip.com (HKLM)
O15 - Trusted Zone: http://update.randhi.com (HKLM)
O16 - DPF: {15589FA1-C456-11CE-BF01-00AA0055595A} - http://w4s.work4sure.com/c/ge/w4sgeen9.exe
O16 - DPF: {33331111-1111-1111-1111-611111193423} -
O16 - DPF: {33331111-1111-1111-1111-611111193429} -
O16 - DPF: {33331111-1111-1111-1111-615111193427} -
O16 - DPF: {33331111-1131-1111-1111-611111193428} -
O16 - DPF: {43331111-1111-1111-1111-611111195622} -
O16 - DPF: {64311111-1111-1121-1111-111191113457} - file://c:\eied_s7.cab


Close ALL programs and browsers (including this one), leaving ONLY HijackThis open, then click "Fix checked".

Then please exit HijackThis.


NEXT:

Using Windows Explorer, please navigate to and delete the following FILES (if they exist):

c:\eied_s7.cab


Please let me know if you encountered any problems finding or deleting the file.


NEXT:

Please download CCleaner (freeware) and save it to your desktop:Run the CCleaner install... Read more

Read other 1 answers
RELEVANCY SCORE 194.4

Hello,Please help if you can .I ran free Avast! version 5.0.677 on my Windows XP desktop computer (Pentium 4, 1.5 Ghz CPU, 1 gb ram), and came up with the following virus warnings. Unfortunately the Avast! software internal tools to remove it are grayed out and not functioning. I tried a couple of things to remove viruses from help online and then realized I was in way over my head. I found this forum and am now requesting help.Avast! says I am affected with:JS:Downloader-AT, Win32:Nimda, Win32:Small-GWM, Win32:VB-EIJ, Win32:WinSpy-CK, JS:ScriptSH-inf, and Win32:VirutAttached a screen shot of Avast! with viruses and partial path to them. Computer's Symptoms (not sure if these are all due to old slow processor or malware):Computer is freezing often;When it is in sleep mode it is turning itself on;Seems to be downloading stuff often and slowing down;Monitor is going black forcing reboots often;Couple weeks back I began getting floating ads that pop up when browsing online;I get an error message daily that says AdAware has shut down unexpectedly, do I want to send a report? I have been ignoring this, not knowing if it was important, been several weeks.Ok, I think that is all I can think of to share. Please help if you can. I appreciate it.Thanks,Dancer~~~~~~~~~~DDS (Ver_10-03-17.01) - NTFSx86 Run by ljk at 15:52:28.93 on Mon 09/20/2010Internet Explorer: 6.0.2900.5512 BrowserJavaVersion: 1.6.0_18Microsoft Windows XP Professional 5.1.2600.3.1252.1.1033.18.102... Read more

A:Please Help ~ Infected with JS:Downloader-AT, Win32:Nimda, Win32:Small-GWM, Win32:VB-EIJ, Win32:WinSpy-CK, JS:ScriptSH-inf, and...

Hello, and to the Malware Removal forum! My online alias is Blade Zephon, or Blade for short, and I will be assisting you with your malware issues!In the upper right hand corner of the topic you will see a button called Options. If you click on this in the drop-down menu you can choose Track this topic. By doing this and then choosing Immediate E-Mail notification and then clicking on Proceed you will be advised when we respond to your topic and facilitate the cleaning of your machine.Before we begin cleaning your machine, I'd like to lay out some guidelines for us to follow while we are working together.I will be assisting you with your malware issues. This may or may not resolve other problems you are having with your computer. If you are still having problems after your machine has been determined clean, I will be glad to direct you to the proper forum for assistance.Even if things appear better, that does not mean we are finished. Please continue to follow my instructions until I give you the all clean. Absence of symptoms does not mean that all the malware has been removed. If a piece of the infection is left, it can regenerate and reinfect your machine. Attention to detail is important! Since I cannot see or directly interact with your computer I am dependent on you to "be my eyes" and provide as much information as you can regarding the current state of your computer.I ask that you please refrain from running tools other than those I su... Read more

Read other 42 answers
RELEVANCY SCORE 192

According to AVG I'm infected with Clicker.AAFT which appears as c:\windows\fonts\services.exe. Task Manager always has at least 2 of these additional services.exe running.I used to have Norton antivirus running but the virus broke it and i couldn't re-install it. I bought the Kaspersky Labs virus scanner but that to would not install. it looks like this virus has changed the "rights" of some objects. The only virus scanner that would install and work was AVG.I tried to re-install service pack 3 thinking it would possibly overwrite some of the virus infected files but I got an "access denied" when I tried to start installing... ARRRRRRRGGGGHHHH!!!!Any help would be much appreciated!/Blair Here's my DDS log: DDS (Ver_09-06-26.01) - NTFSx86 Run by Blair at 15:18:10.15 on 2009-07-11Internet Explorer: 7.0.5730.11Microsoft Windows XP Professional 5.1.2600.3.1252.1.1033.18.3071.2127 [GMT -4:00]AV: AVG Anti-Virus Free *On-access scanning enabled* (Updated) {17DDD097-36FF-435F-9E1B-52D74245D6BF}AV: Kaspersky Internet Security *On-access scanning disabled* (Updated) {2C4D4BC6-0793-4956-A9F9-E252435469C0}AV: ESET NOD32 antivirus system 2.70 *On-access scanning enabled* (Updated) {E5E70D32-0101-4F12-8FB0-D96ACA4F34C0}============== Running Processes ===============C:\WINDOWS\system32\svchost -k DcomLaunchsvchost.exeC:\WINDOWS\System32\svchost.exe -k netsvcsC:\WINDOWS\system32\sv... Read more

A:Infected with Clicker.AAFT Win32.Delf.rtk Win32.Agent.atta

I just noticed that I'm also infected with Virtumonde in
C:\WINDOWS\system32\sopidkc.exe

/Blair

Read other 15 answers
RELEVANCY SCORE 191.2

I have an F-Secure internet security software suite on this computer, and it is up-to-date and functioning. I also have MalwareBytes (free) installed and have been running it regularly, and I use the ESET Online Scanner as well. The OS is Windows XP, and it is up-to-date.About three weeks ago I cleaned around three trojans from this computer using MBAM and the online scanner. A few days ago, Adware.Win32.WebHancer.x was found by F-Secure, and is currently quarantined. Today, several instances of the two Trojan-Spy programs were found and quarantined by F-Secure; they infect system files and system restore files. I already looked up information on cleaning the system restore files by stopping and restarting system restore (and scanning inbetween). I deleted the quarantined files.All of the Spy-Trojan's found are infecting in C:\hp\recovery\wizard\fscommand\. The file names are:AppRecoveryLink_ret.exeCDLogic_ret.exeCreatorLink_ret.exeRestoreLink_ret.exeRTCDLink_ret.exeRunLink_ret.exeSysRecoveryLink_ret.exeWizardLink_ret.exeThe Adware infected a .dll file, and I was advised not to delete it.CDLogic_ret.exe is Agent.bdzz; the rest are Agent.beafI have run my antivirus, MBAM, and the online scanner again and they picked up nothing. Also, the Adware and Trojan-Spy's were all found during MBAM scans, but F-Secure picked them up.I have attached a HiJackThis log and a DDS log; GMER froze my computer partway through the scan when I used it. I have ran a... Read more

A:Infected with Trojan-Spy.Win32.Agent.bdzz, Trojan-Spy.Win32.Agent.beaf, and Adware.Win32.WebHancer.x

Hello and welcome to Bleeping ComputerWe apologize for the delay in responding to your request for help. Here at Bleeping Computer we get overwhelmed at times, and we are trying our best to keep up. Please note that your topic was not intentionally overlooked. Our mission is to help everyone in need, but sometimes it takes just a little longer to get to every request for help. No one is ignored here.If you have since resolved the original problem you were having, we would appreciate you letting us know. If not please perform the following steps below so we can have a look at the current condition of your machine. If you have not done so, include a clear description of the problems you're having, along with any steps you may have performed so far.Upon completing the steps below another staff member will review and take the steps necessary with you to get your machine back in working order clean and free of malware.If you have already posted a DDS log, please do so again, as your situation may have changed.Use the 'Add Reply' and add the new log to this thread.Thanks and again sorry for the delay.We need to see some information about what is happening in your machine. Please perform the following scan:Download DDS by sUBs from one of the following links. Save it to your desktop.DDS.scrDDS.pifDouble click on the DDS icon, allow it to run.A small box will open, with an explaination about the tool. No input is needed, the scan is running.Notepad will open with the results.Foll... Read more

Read other 2 answers
RELEVANCY SCORE 190.4

Hello,My computer became infected last night, and It's pretty bad. I became infected with Infected: Trojan:Win32/Alureon.BT, Win32:Jifas-CY, and the others listed (maybe more). Long story short, I'd just watched Harry Potter on dvd, and logged onto the computer to see who he married in the end. I ended up at a Harry Potter encyclipdiea website, and looked it up. Avast went nuts after a few minutes, and showed 4 different virus alerts, and Windows Defender showed 1 as well after I shut down.The virus listed by Defender was Trojan:Win32/Alureon.BT. Avast listed Win32:Jifas-CY, I didn't get the others in time.The last 2 I listed in the title, a "security center alert" claimed it detected these programs trying to acess the internet. It listed one more, but I didn't get it's name in time.I know Alureon is a downloader and backdoor for other viruses, and it basically shuts down security systems, which it's trying to do since windows now thinks I have no anti-virus installed.All of these trojans are listed as "server" and "high risk." I'm not sure a root kit didn't try to make it's way in too.EDIT: I wanted to add a few things in. First, I have XP SP3 set up with multiple accouts, one admin "owner" account and then 1 limited access "user" account. The Viruses came in while the user account was logged on (I am not dumb enough to connect to the internet with an admin account). It seems the Viruses we... Read more

A:Infected: Trojan:Win32/Alureon.BT, Win32:Jifas-CY, Backdoor.Win32.Kbot.al, Net-Worm.Win32.Mytob.t

Hello again.I booted into Safe Mode and ran an Avast scan (which took forever) and it was a waste of time. The stupid thing found nothing wrong, and said the system was clean (which is the opposite it says when you log into the limited user account). The computer (and specially that account at least) is definitely infected. Could the viruses be hiding themselves when in safe mode?Should I scan from a Pre-install environment like BartPE? Or from the Regular "Owner" Admin account? I waited 2 days for the stupid program to scan 700gb (painfully slow for a qaud core, though to be excepted in safe mode), and it was useless.Other than running windows defender (which I'm doing now), and maybe trying MBAM, I'm not sure what to do. I'm not expect enough to dive into programs like OTViewIT and Combofix, so I'll need help here. Please, ANY HELP is appreciated. I would rather NOT wipe the drive and reinstall the whole system, but I need to get this figured out.Does no one have any ideas???

Read other 5 answers
RELEVANCY SCORE 187.2

The last two days my computer has frozen up while trying to surf around online. This seemed weird so I ran a full system scan with symantec endpoint both days. Both times the logs came back with no risks detected. Today I started getting internet explorer pops directing me to sites. I knew at this point I had an infection that endpoint was not picking up. I disabled my network card and used another computer to download some of the suggest programs I've seen on this site. I has hoping to at least get the problem quarantined so that I would feel safe enough to enable the network card again. After running the utilities, I am not freezing when surfing web pages and have resumed using the computer. I would like help making sure that my computer is clean since endpoint obviously isn't catching this problem. Below are the logs for Kaspersky Online Scan & DSS.Deckard's System Scanner v20071014.68Run by bgedeon on 2008-07-29 14:40:22Computer is in Normal Mode.---------------------------------------------------------------------------------- HijackThis (run as bgedeon.exe) ---------------------------------------------Logfile of Trend Micro HijackThis v2.0.2Scan saved at 14:40, on 2008-07-29Platform: Windows XP SP3 (WinNT 5.01.2600)MSIE: Internet Explorer v6.00 SP3 (6.00.2900.5512)Boot mode: NormalRunning processes:C:\WINDOWS\System32\smss.exeC:\WINDOWS\system32\winlogon.exeC:\WINDOWS\system32\services.exeC:\WINDOWS\s... Read more

A:Infected With Trojan.win32.monder.bcb & Trojan-downloader.win32.agent.xxa

I continued to investigate on my own. Combofix quaratined some files, but did not delete them. A scheduled full system scan with endpoint finally picked up some infections with the newest updates loaded. Symantec scan labels the infections as Trojan.Vundo and Trojan.Metajuan. Metajuan was removed automatically, but Vundo proved to be a little more pesky. Symantec offers a removal tool for Vundo on there website. I opted to try out Malwarebytes' Anti-Malware (mbam). It was able to located the files that were in quaratine and some infected files that were in system restore. I disable system restore to avoid any problems and mbam was able to delete all the files. After a system restart, I scanned with Symantec Vundo tool and found no further signs of infection. Mbam did a good job Re-enabled system restore and recreated a fresh restore point. I'm hoping that this will be in the end of this problem, but would still be interested in someone combing through some of my logs to see if anything was missed. I'm still a little miffed that endpoint had not picked these infections up when they are not exactly new threats and I had the most current definitions when I ran my previous scans.

Read other 10 answers
RELEVANCY SCORE 182.4

Hi,I'm running Windows XP - Internet Explorer v. 6.00, SP3. Yesterday Avast alerted me to a virus on my computer (I neglected to write down the exact message). At the time, only Gmail was open and an email was being written. I've had some issues with Avast occasionally reporting a false positive, and since nothing was being downloaded at that time, I took no action with Avast. Instead, I immediately did a Quick Scan with MalwareBytes to see if it would find anything. MalwareBytes found and deleted the following: C:\Documents and Settings\HP_Owner\application data\Sun\Java\deployment\cache\\6.0\44\61b86cac-3c0c0928Trojan.FakeAlert.VGenC:\Documents and Settings\HP_Owner\local settings\temp\0.506697477033.exeTrojan.FakeAlert.VGenA second MalwareBytes scan was clean.I looked "Trojan.FakeAlert.VGen" up on Google and then it clicked: for the past few days, Adobe Flash Player has been crashing an awful lot. When it crashes (on Youtube, for example), it tells me the program is out of date and needs to be updated. The weird thing was that sometimes it worked for a while before it crashed, but I dismissed that as being some strange computer quirk. I went to the Adobe web site and tried to install the newest version of Flash Player, but was unable to. I feel foolish, but it never even occurred to me that a virus could be to blame. It concerns me that (assuming the Adobe Flash Pla... Read more

A:Trojan.FakeAlert.VGen, SpyInstall_HPPre.exe, Win32: Mirc-z [PUP], Win32: Kill App-W [PUP] & Win32: Agent-AMXO (Trj)

Download Security Check from HERE, and save it to your Desktop. * Double-click SecurityCheck.exe * Follow the onscreen instructions inside of the black box. * A Notepad document should open automatically called checkup.txt; please post the contents of that document.=============================================================================Please download MiniToolBox and run it.Checkmark following boxes:Report IE Proxy SettingsReport FF Proxy SettingsList content of HostsList IP configurationList last 10 Event Viewer logList Users, Partitions and Memory sizeClick Go and post the result.=============================================================================Download Malwarebytes' Anti-Malware (aka MBAM): http://www.malwarebytes.org/products/malwarebytes_free to your desktop. * Double-click mbam-setup.exe and follow the prompts to install the program. * At the end, be sure a checkmark is placed next to Update Malwarebytes' Anti-Malware and Launch Malwarebytes' Anti-Malware, then click Finish. * If an update is found, it will download and install the latest version. * Once the program has loaded, select Perform quick scan, then click Scan. * When the scan is complete, click OK, then Show Results to view the results. * Be sure that everything is checked, and click Remove Selected. * When completed, a log will open in Notepad. * Post the log back here.Be sure to restart the computer.The log can also be found here:C:\Document... Read more

Read other 13 answers
RELEVANCY SCORE 182

I believe that I have been infected by the following Virus: Rootkit.Agent/Gen-DNSHack; WIN32.Downloader.Small.afwj; Win32.Trojan.Dropper.VB.TR. They were all removed by either Zone Alarm Anti-Spyware and SuperAntiSpyware. However, I continue to have the symptoms: sporadic hijack of my keyboard so keystrokes are exected in what appears to be a random fashion. I say it's random because most of the time what's typed by the virus doesn't make any sese.I was working with FAX in the ZoneAlarm user forum who recomended the malware removal tools and suggested I post my Hijackthis log if all else failed. All else has failed. Following is the log. Thanks for your help.
 hijackthis.log   16.26KB
  17 downloadsLogfile of Trend Micro HijackThis v2.0.2Scan saved at 1:13:46 PM, on 6/28/2009Platform: Windows Vista SP2 (WinNT 6.00.1906)MSIE: Internet Explorer v8.00 (8.00.6001.18702)Boot mode: NormalRunning processes:C:\Program Files (x86)\Siber Systems\AI RoboForm\robotaskbaricon.exeC:\Program Files (x86)\WinZip\WZQKPICK.EXEC:\Program Files (x86)\WordWeb\wweb32.exeC:\Program Files (x86)\Hewlett-Packard\Media\DVD\DVDAgent.exeC:\Program Files (x86)\Hewlett-Packard\TouchSmart\Media\TSMAgent.exeC:\Program Files (x86)\Hewlett-Packard\TouchSmart\Media\Kernel\CLML\CLMLSvc.exeC:\Program Files (x86)\HPQ\HP Connection Manager 2�... Read more

A:Infection by Rootkit.Agent/Gen-DNSHack; WIN32.Downloader.Small.afwj; Win32.Trojan.Dropper.VB.TR

Hello and welcome to Bleeping ComputerWe apologize for the delay in responding to your request for help. Here at Bleeping Computer we get overwhelmed at times, and we are trying our best to keep up. Please note that your topic was not intentionally overlooked. Our mission is to help everyone in need, but sometimes it takes just a little longer to get to every request for help. No one is ignored here.If you have since resolved the original problem you were having, we would appreciate you letting us know. If not please perform the following steps below so we can have a look at the current condition of your machine. If you have not done so, include a clear description of the problems you're having, along with any steps you may have performed so far.Upon completing the steps below another staff member will review and take the steps necessary with you to get your machine back in working order clean and free of malware.If you have already posted a DDS log, please do so again, as your situation may have changed.Use the 'Add Reply' and add the new log to this thread.Thanks and again sorry for the delay.We need to see some information about what is happening in your machine. Please perform the following scan:We need to create an OTL ReportPlease download OTL from one of the following mirrors:This is THE MirrorSave it to your desktop.Double click on the icon on your desktop.Click the "Scan All Users" checkbox.Push the button.Two reports will open, copy and paste them in a... Read more

Read other 26 answers
RELEVANCY SCORE 179.6

hi , kaspersky scan(included at the end ) came up with a few infections, please help me with removal logs:Logfile of random's system information tool 1.04 (written by random/random)Run by Yanai Michael at 2008-12-14 13:16:05Microsoft Windows XP Home Edition Service Pack 3System drive C: has 4 GB (9%) free of 53 GBTotal RAM: 1526 MB (53% free)Logfile of Trend Micro HijackThis v2.0.2Scan saved at 13:16:16, on 14/12/2008Platform: Windows XP SP3 (WinNT 5.01.2600)MSIE: Internet Explorer v7.00 (7.00.6000.16762)Boot mode: NormalRunning processes:C:\WINDOWS\System32\smss.exeC:\WINDOWS\system32\winlogon.exeC:\WINDOWS\system32\services.exeC:\WINDOWS\system32\lsass.exeC:\WINDOWS\System32\ibmpmsvc.exeC:\WINDOWS\system32\svchost.exeC:\WINDOWS\System32\svchost.exeC:\Program Files\Intel\Wireless\Bin\EvtEng.exeC:\Program Files\Intel\Wireless\Bin\S24EvMon.exeC:\WINDOWS\system32\spoolsv.exeC:\Program Files\Bonjour\mDNSResponder.exeC:\Program Files\CheckPoint\SSL Network Extender\slimsvc.exeC:\Program Files\Google\Common\Google Updater\GoogleUpdaterService.exeC:\Program Files\IBM\IBM Rapid Restore Ultra\rrpcsb.exeC:\Program Files\Common Files\Microsoft Shared\VS7Debug\mdm.exeC:\Program Files\Microsoft LifeCam\... Read more

A:got Trojan.Win32.Agent.asvc Trojan-GameThief.Win32.Magania.amrr Worm.Win32.AutoRun.trh

Welcome to the BleepingComputer Forums. Since it has been a few days since you scanned your computer with HijackThis, we will need a new HijackThis log. If you have not already downloaded Random's System Information Tool (RSIT), please download Random's System Information Tool (RSIT) by random/random which includes a HijackThis log and save it to your desktop. If you have RSIT already on your computer, please run it again. Double click on RSIT.exe to run RSIT. Click Continue at the disclaimer screen. After it has finished, two logs will open. Please post the contents of both. log.txt will be maximized and info.txt will be minimized. Thank you for your patience.Please see Preparation Guide for use before posting about your potential Malware problem. Thank you for your patience.If you have already posted this log at another forum or if you decide to seek help at another forum, please let us know. There is a shortage of helpers and taking the time of two volunteer helpers means that someone else may not be helped. While we are working on your HijackThis log, please: Reply to this thread; do not start another! Do not make any changes on your computer during the cleaning process or download/add programs on your computer unless instructed to do so. Do not run any other tool until instructed to do so! Let me know if any of the links do not work or if any of the tools do not work. Tell me about problems or symptoms that occur during the fix. Do... Read more

Read other 7 answers
RELEVANCY SCORE 178

Avast continually blocks the following threats: - Win32:Malware-gen - WIn32:Downloader-PKU [Trj] - Win32:DNSChanger-VJ [Trj]Avast scans and detects Win32:Sirefef-PL [Rtk], cannot remove it though.Malwarebytes scan detects BCminer, quarantines it, though never seems to get rid of BCminer. Other issues of possible note: - Windows Firewall not running 0x80070424 - Backup & Restore - last backup did not complete successfully - server execution failed - 0x80080005Ran both DDS and GMER (GMER did not have all the options available as per the preparation guide, and did not log anything when the scan was complete). .DDS (Ver_2011-08-26.01) - NTFSAMD64 Internet Explorer: 9.0.8112.16421Run by Family-pc at 12:37:05 on 2012-08-05Microsoft Windows 7 Home Premium 6.1.7601.1.1252.2.1033.18.16383.13888 [GMT -4:00].SP: Windows Defender *Disabled/Updated* {D68DDC3A-831F-4fae-9E44-DA132C1ACF46}.============== Running Processes ===============.C:\Windows\system32\wininit.exeC:\Windows\system32\lsm.exeC:\Windows\system32\svchost.exe -k DcomLaunchC:\Windows\system32\svchost.exe -k RPCSSC:\Windows\system32\atiesrxx.exeC:\Windows\System32\svchost.exe -k LocalServiceNetworkRestrictedC:\Windows\System32\svchost.exe -k LocalSystemNetworkRestrictedC:\Windows\system32\svchost.exe -k netsvcsC:\Windows\system32\svchost.exe -k LocalServiceC:\Windows\sy... Read more

A:Win32:Sirefef-PL, Win32:Malware-gen, WIn32:Downloader-PKU [Trj], Win32:DNSChanger-VJ [Trj], BCMiner need help

Hello Njals, Welcome to Bleeping Computer.
My name is fireman4it and I will be helping you with your Malware problem.

Please take note of some guidelines for this fix:
Refrain from making any changes to your computer including installing/uninstall programs, deleting files, modifying the registry, and running scanners or tools.
If you do not understand any step(s) provided, please do not hesitate to ask before continuing.
Even if things appear to be better, it might not mean we are finished. Please continue to follow my instructions and reply back until I give you the "all clean".
In the upper right hand corner of the topic you will see a button called Watch Topic.I suggest you click it and select Immediate E-Mail notification and click on Proceed. This way you will be advised when we respond to your topic and facilitate the cleaning of your machine.

Finally, please reply using the ADD REPLY button in the lower right hand corner of your screen. Do not start a new topic. The logs that you post should be pasted directly into the reply, unless they do not fit into the post.
I will be analyzing your log. I will get back to you with instructions.Do you have a USB Flash Drive you can use?

Read other 21 answers
RELEVANCY SCORE 177.6

I believe I was infected last night when a website somehow redirected me to liteautogreatest{dot}cn.I'm running XP Home SP3 and the ZoneAlarm Internet Security Suite (just updated earlier today).ZoneAlarm continually finds a couple of problems and hibernates them but they do not go completely away after a reboot.The ZoneAlarm active monitor scan shows the following...Trojan-Dropper.Win32.Agent.amzh was found in C:\Documents and Settings\Don\Local Settings\Temp\BNB.tmp on 4/20/2009 13:29:22Trojan-Dropper.Win32.Agent.amzh was found in C:\Documents and Settings\Don\Local Settings\Temp\BNA.tmp on 4/20/2009 13:23:26Trojan-Dropper.Win32.Agent.amzh was found in C:\Documents and Settings\Don\Local Settings\Temp\BN9.tmp on 4/20/2009 13:17:40Trojan-Dropper.Win32.Agent.amzh was found in C:\Documents and Settings\Don\Local Settings\Temp\BN8.tmp on 4/20/2009 13:14:30Trojan-Dropper.Win32.Agent.amzh was found in C:\Documents and Settings\Don\Local Settings\Temp\BN7.tmp on 4/20/2009 13:07:26Trojan-Dropper.Win32.Agent.amzh was found in C:\Documents and Settings\Don\Local Settings\Temp\BN6.tmp on 4/20/2009 13:02:40Rootkit.Win32.Agent.ikz was found in C:\WINDOWS\system32\drivers\systemntmi.sys on 4/20/2009 12:57:48Trojan-Dropper.Win32.Agent.amzh was found in C:\Documents and Settings\Don\Local Settings\T... Read more

A:Infected with Rootkit.Win32.Agent.ikz, Trojan-Dropper.Win32.Agent.amzh, Trojans? Malware?

Please download ATF Cleaner by Atribune & save it to your desktop. DO NOT use yet.alternate download linkThen download and install SUPERAntiSpyware FreeDouble-click SUPERAntiSypware.exe and use the default settings for installation.An icon will be created on your desktop. Double-click that icon to launch the program.If it will not start, go to Start > All Prgrams > SUPERAntiSpyware and click on Alternate Start.If asked to update the program definitions, click "Yes". If not, update the definitions before scanning by selecting "Check for Updates". (If you encounter any problems while downloading the updates, manually download them from here. Double-click on the hyperlink for Download Installer and save SASDEFINITIONS.EXE to your desktop. Then double-click on SASDEFINITIONS.EXE to install the definitions.)In the Main Menu, click the Preferences... button.Click the "General and Startup" tab, and under Start-up Options, make sure "Start SUPERAntiSpyware when Windows starts" box is unchecked.Click the "Scanning Control" tab, and under Scanner Options, make sure the following are checked (leave all others unchecked):Close browsers before scanning.Scan for tracking cookies.Terminate memory threats before quarantining.Click the "Close" button to leave the control center screen and exit the program.Do not run a scan just yet.Reboot your computer in "Safe Mode" using the F8 method. To do this, re... Read more

Read other 3 answers
RELEVANCY SCORE 177.2

hello. sorry about this mess. im afraid i dont really know what im doing. my nephew asked me to help get rid of a red circle with a white cross telling him he had spyware but its turned into something much worse. he only used windows firewall and nothing else saying he only uses world of warcraft and msn and music and doesnt surf the web!! i tried to scan with avg but it was aborted and the windows firewall was continually turned off no matter how many times i put it on. tried other antivirus progs but all were turned off. eventually i managed to do online scan on microsoft safety centre and deleted quite a few v high threat trojans but many unable to clean. i also ran sophos rootkit and nearly gave myself a heart attack - 938 hidden things that recommend not to clean. i resorted to you now. i followed the tutorial for posting hijack this and here are the resultskaspersky report for critical areas--------------------------------------------------------------------------------KASPERSKY ONLINE SCANNER 7 REPORT Saturday, November 29, 2008 Operating System: Microsoft Windows XP Professional Service Pack 3 (build 2600) Kaspersky Online Scanner 7 version: 7.0.25.0 Program database last update: Saturday, November 29, 2008 12:40:36 Records in database: 1426420--------------------------------------------------------------------------------Scan settings: Scan using the following database: extended Scan archives: yes Scan mail databases: yesScan area - Critical Areas: C:\Do... Read more

A:win32/alureon.gen, win32/Eldycow.en!A, win32/Small, win32/Olmafik, winNT/Xantvi.gen!A, Trojan-Game Thief and more

i think i have sorted this. i ran SDFix which cleaned up enough for me to install antivirus. avast caught lots of trojans and i have now been able to onlinescan and spybot s/d etc. all logs now coming back clean so can u delete this post please

Read other 3 answers
RELEVANCY SCORE 175.2

Hello!I have trouble with my computer. I found this forum online and now I hope that you can help me. I suspected that I had a virus so I installed a anti-virus program. It found files with the names virus.win32.sality.k and trojan-proxy.win32.agent.II on my computer. After desinfecting those files I always got an error message when I turned the computer on. It kept telling me: file vmmdiag32.exe cannot be found. Then I found this forum and saw that other people had the same problem and that this is still a consequence of the virus. I don?t know how to get rid of it.Then I found your preparation guide for use before posting a hijackthis log, and checked my computer with the programs you adviced. Now that errormessage has disappeared, but I have the impression that my computer doesn?t work properly anymore. It?s getting slower and the anti-virus programm always finds new infected files. Sometimes when I turn the computer on it gets stuck while it is booting up and I have to press F1 to continue.Now there?s a problem with the audio too - I don?t know if it is also a result of the virus. It tells me: bad directsound driver. please install proper drivers or select another device in configuration. error code: 88780078. and the only sound the computer makes is a terrible peep sound.I have never had a virus before (I didn?t have internet on my computer), so I?m a little bit helpless and I would really appreciate it if you could help me.I also did the Hijackthis. here is the res... Read more

A:Infected With: Virus.win32.sality.k; Trojan-proxy.win32.agent.ii

Hi schag1,

If you still need help please post a fresh HijackThis log and I'll be happy to look at it for you.

Thanks for your patience.

Read other 6 answers
RELEVANCY SCORE 174.4

I use ESET NOD32. At startup it detects the win32/Kryptik in a start-up scan and later mentions the Win32 rootkit running in memory. The scan log shows that it has detected this on each startup but it cannot delete because files are locked from removal. I have not been able to tell what file NOD is trying to find. Below is last log file post: This same message is repeated in numerous 10+ restarts in the past 24 hours.

5/19/2009 8:25:51 PM Startup scanner file \\?\globalroot\systemroot\system32\gxvxctxujtymqsiltimrpcilnqyirvmqgrlhk.dll a variant of Win32/Kryptik.PF trojan cleaned by deleting (after the next restart) - quarantined
5/19/2009 8:25:46 PM Startup scanner operating memory Operating memory Win32/Rootkit.Agent.ODG trojan unable to clean

I have run ESET in safe mode. It didnot do anything to eliminate the problem. Windows Defender has apparently not done anything either. Finally, I tried windows malicious software removal, but apparently it could not do anything either.

Main problem I notice is delays in internet usage. Happens both in firefox and ie. I changed DNS settings from automatically detect to a fixed DNS setting from earthlink.net. Still same slow down in internet usage.

Appreciate any help you can give. I have tried to find bad file, but to no avail.

Thanks
===============================================

DDS (Ver_09-05-14.01) - NTFSx86
Run by Pop at 21:38:42.70 on Tue 05/19/2009
Internet Explorer: 7.0.... Read more

A:Infected with Win32/Krptik.PF and win32/Rootkit.agent.odg.trojan

It now looks like I may have been able to repair my problem. I used a somewhat, haphazard, unguided approach to removal. The final solution came from AVG Rootkit removal ( http://download.cnet.com/AVG-Anti-Rootkit-...4-10662685.html ). Here is a list of all the steps I attempted. I was worried at times I could have hurt my system, but then I would have had to reinstall the OS. But, on the other hand, some internet posts I read were saying that was the only way to repair the situation. So, desperation took hold. I found my reinstall disks, just in case I needed them and proceeded. ATF Cleaner -- Who needs temp files anyway, especially if they might have trojans, I eliminated temp files this program would find.CC Cleaner - used this to clean out internet cache and history.Recycler folders - I had multiple recycler folders, one that had a rundll in it. I assumed you only have one recycle bin so you only need one of these folders. I had to reset the folder view options in exlorer to see all files and folders (hidden, system, etc.) I deleted the extra recycler folders I could find.System Restore - I turned off system restore. This would erase all the previous positions I had saved. This meant I could never go back to a prior position where my computer was running good, but I didn't know how to find out if I had virus/trojan in one of these saved files I then immediately turned back on the system restore after the old restore files were deleted.b]Windows defender[... Read more

Read other 2 answers
RELEVANCY SCORE 174.4

My computer is infected with Win32.Trojan.Tdss and Win32.TrojanDownloader.Agent. I've been trying to remove them with Ad-Aware but they re-install themselves. I've downloaded numorous other malware removers but the malware seems to disrupt / won't allow them to install or work. This includes the root repeal program mentioned in the preparation guide. When I attempt to run root repeal I get the following error:

04:03:06: FOPS - DeviceIoControl Error! Error Code = 0xc0000024 Extended Info (0x000000d8)
04:03:06: DeviceIoControl Error! Error Code = 0x1e7
04:03:06: FOPS - DeviceIoControl Error! Error Code = 0xc0000024 Extended Info (0x000000d8)

The most annoying thing that is happening is when I go to google something, it will redirect me to somewhere else or will throw random pop-ups at me every now and then. Also, I tried to reformat / re-install a fresh copy of Windows Vista but it seems this piece of malware makes it impossible to boot from disk.

Thank you in advance for your assistance!

Attached below is my dds.txt log:

DDS (Ver_09-07-30.01) - NTFSx86
Run by Jeff at 3:59:19.84 on Fri 08/28/2009
Internet Explorer: 7.0.6000.16890
Microsoft? Windows Vista???? Home Premium 6.0.6000.0.1252.1.1033.18.2046.1362 [GMT 9:00]

SP: Lavasoft Ad-Watch Live! *disabled* (Updated) {67844DAE-4F77-4D69-9457-98E8CFFDAA22}
SP: Windows Defender *enabled* (Updated) {D68DDC3A-831F-4FAE-9E44-DA132C1ACF46}

============== Running Processes ===============

C:\... Read more

A:Infected With Win32.Trojan.Tdss and Win32.TrojanDownloader.Agent

Hello and welcome to Bleeping ComputerWe apologize for the delay in responding to your request for help. Here at Bleeping Computer we get overwhelmed at times, and we are trying our best to keep up. Please note that your topic was not intentionally overlooked. Our mission is to help everyone in need, but sometimes it takes just a little longer to get to every request for help. No one is ignored here.If you have since resolved the original problem you were having, we would appreciate you letting us know. If not please perform the following steps below so we can have a look at the current condition of your machine. If you have not done so, include a clear description of the problems you're having, along with any steps you may have performed so far.Upon completing the steps below another staff member will review and take the steps necessary with you to get your machine back in working order clean and free of malware.If you have already posted a DDS log, please do so again, as your situation may have changed.Use the 'Add Reply' and add the new log to this thread.Thanks and again sorry for the delay.We need to see some information about what is happening in your machine. Please perform the following scan:Download DDS by sUBs from one of the following links. Save it to your desktop.DDS.scrDDS.pifDouble click on the DDS icon, allow it to run.A small box will open, with an explaination about the tool. No input is needed, the scan is running.Notepad will open with the results.Foll... Read more

Read other 3 answers
RELEVANCY SCORE 174

m ades, windows xp sp3
to whomever can help- i tried to remove some viruses
using info from bleeping, but am not having any luck.

i downloaded a file that i thought could help me on another
matter, but it had a virus that zone alarm's active scan did not
catch.

it was a rootkit virus. i tried tdsskiller several times as well as
malwarebytes, and thought i finally got rid of it. then another
virus popped up despite my not having connected to the internet.

another was this patch virus that kept redirecting my opera
browser. malwarebytes did not see this, but zone alarm did.
i tried to get rid of it and used tdsskiller, and thought i did.
i had to keep switching between safe mode and
normal mode to do it. i had no problems for two weeks, then
both seemed to pop up again. my guess is that i never
actually got rid of them. i tried zone alarm, malwarebytes,
and tdsskiller over and over again, with no luck. then my
ability to connect to the net went away. i gave up and restored
my hdd using the file i made just after i thought i had gotten
rid of the problems, so that though i would still have the viruses,
i would get back the net. using tdsskiller and malwarebytes
still did not work, and a new virus showed up. .

i'm including the logs from zone alarm, malwarebytes, and tdsskiller.

i would really appreciate help.

first to show up. used tdsskiller, seemed to be removed, kept showing back up.

(Forged): C:\WINDOWS\system32... Read more

A:infected with Rootkit.Win32.ZAccess.e, HiddenFile.Multi.Generic, Trojan.Win32.Patched.mf,, Backdoor.Agent.Gen) -> Value: Sh...

ps i have mbam, zone alarm,tdss,
and hijack logs, but was not sure
how to post them since the number
of text characters on this page
was limited.

Read other 70 answers
RELEVANCY SCORE 173.6

There are several trojan horse detected such as Trojan-Backdoor.Win32.Agent.sp,Trojan-Downloader.Win32.QQhelper.kb, Trojan-PSW.Win32.OnlineGame.qy,Trojan-PSW.Win32.OnlineGame.yn, Trojan-BAT.KillAV.es, Trojan-proxy.Win32.small.du, Trojan-Downloader.Win32.Zlob.gj and many more...I do not know how to remove those trojan, pls HELP!!!Logfile of HijackThis v1.99.1Scan saved at 10:49:43 PM, on 7/6/2007Platform: Windows XP SP2 (WinNT 5.01.2600)MSIE: Internet Explorer v6.00 SP2 (6.00.2900.2180)Running processes:C:\WINDOWS\System32\smss.exeC:\WINDOWS\system32\csrss.exeC:\WINDOWS\system32\winlogon.exeC:\WINDOWS\system32\services.exeC:\WINDOWS\system32\lsass.exeC:\WINDOWS\system32\Ati2evxx.exeC:\WINDOWS\system32\svchost.exeC:\WINDOWS\system32\svchost.exeC:\WINDOWS\System32\svchost.exeC:\WINDOWS\system32\svchost.exeC:\WINDOWS\system32\Ati2evxx.exeC:\WINDOWS\system32\svchost.exeC:\WINDOWS\system32\spoolsv.exeC:\WINDOWS\Explorer.EXEC:\Program Files\CyberLink\PowerDVD\PDVDServ.exeC:\Program Files\Lavasoft\Ad-Aware 2007\aawservice.exeC:\Program Files\Microsoft Office\Office12\GrooveMonitor.exeC:\WINDOWS\FixCamera.exeC:\WINDOWS\tsnp2std.exeC:\WINDOWS\vsnp2std.exeC:\WINDOWS\system32... Read more

A:Several Trojan Such As Trojan-backdoor.win32.agent.sp, Downloader.win32 .qqhelper.kb

Sorry for the delay. If you are still having problems please post a brand new HijackThis log as a reply to this topic. Before posting the log, please make sure you follow all the steps found in this topic:Preparation Guide For Use Before Posting A Hijackthis LogPlease also post the problems you are having.

Read other 1 answers
RELEVANCY SCORE 172.8

Hi! My real-time Anti-virus protection filter (Eset Nod32) has registered som virus activity for the past couple of weeks that i cant seem to get rid of:2010-03-22 11:26:47 Real-time file system protection file I:\System Volume Information\_restore{9307B358-B690-49BE-8C17-30DE253AE1DB}\RP828\A0122539.exe probably a variant of Win32/Agent trojan cleaned by deleting - quarantined NT INSTANS\SYSTEM Event occurred on a file modified by the application: C:\WINDOWS\System32\svchost.exe.2010-03-22 10:34:42 Real-time file system protection file E:\System Volume Information\_restore{9307B358-B690-49BE-8C17-30DE253AE1DB}\RP828\A0123560.exe a variant of Win32/Kryptik.W trojan cleaned by deleting - quarantined NT INSTANS\SYSTEM Event occurred on a file modified by the application: C:\WINDOWS\System32\svchost.exe.2010-03-22 10:34:36 Real-time file system protection file I:\System Volume Information\_restore{9307B358-B690-49BE-8C17-30DE253AE1DB}\RP828\A0122537.exe probably a variant of Win32/Agent trojan cleaned by deleting - quarantined NT INSTANS\SYSTEM Event occurred on a file modified by the application: C:\WINDOWS\System32\svchost.exe.The files (same trojan /s but different executable names after each deletion, for ex: it varies between A0005757.exe, A0005757.inf and svchost.exe and so on) comes keep comming back after deletion of files in qurantine. The DDS l... Read more

A:Infected by Win32/Agent & Win32/kryptik.W Trojan

Hello and welcome to Bleeping ComputerWe apologize for the delay in responding to your request for help. Here at Bleeping Computer we get overwhelmed at times, and we are trying our best to keep up. Please note that your topic was not intentionally overlooked. Our mission is to help everyone in need, but sometimes it takes just a little longer to get to every request for help. No one is ignored here.If you have since resolved the original problem you were having, we would appreciate you letting us know. If not please perform the following steps below so we can have a look at the current condition of your machine. If you have not done so, include a clear description of the problems you're having, along with any steps you may have performed so far.Upon completing the steps below another staff member will review and take the steps necessary with you to get your machine back in working order clean and free of malware.If you have already posted a DDS log, please do so again, as your situation may have changed.Use the 'Add Reply' and add the new log to this thread.Thanks and again sorry for the delay.We need to see some information about what is happening in your machine. Please perform the following scan:Download DDS by sUBs from one of the following links. Save it to your desktop.DDS.scrDDS.pifDouble click on the DDS icon, allow it to run.A small box will open, with an explaination about the tool. No input is needed, the scan is running.Notepad will open with the results.Foll... Read more

Read other 3 answers
RELEVANCY SCORE 172.4

Hello gracious support people,

I downloaded a bad file from my bit-torrent program that installed many viruses on my computer. I tried to do a system restore but no restore points are restoring successfully. My firewall keeps catching rundll32.exe trying to access cpmsky.biz on line. There is also trojan-clicker.win32.agent.afr. Other things that are happening is pop-ups and sound files playing. I used the online Panda ActiveScan and have attached the text file here. Hopefully someone can help!

Read other answers
RELEVANCY SCORE 172.4

(DDS log below)I re-installed my AV after running without it for a while and found that I had quite a few bad things going on picked up by Nod32 including (see attachment for more detail):Win32/Olmarik.ZCJava/TrojanDownloader.Agent.NBEa variant of Win32/Olmarik.UL trojanWin32/Cimag.CL trojanI also get multiple outbound connection attempts which are at least partially being blocked by Nod32 to weird .cc .cn and a few .com domain urls, this happens after performing a google search. Also getting some browser redirects going on and homepage changes.I tried setting nod32 to pre-release updates and performing a full scan, this picked up the above and removed them, but after a reboot there are still things going on. Before reading the steps on this site, I ran the latest ComboFix twice which picked up a rootkit in intelide.sys both times, but appears to come back each time. While I disabled nod32 when I ran ComboFix, it re-enabled upon reboot automatically, not sure if that matters.I've also been getting a startup delay of around 1 minute after logon, in this time, nothing appears to be going on (no apparent CPU or disk activity), but wireless, AV and other startup items do not run. Then a minute later, everthing fires up.I've tried running GMER several times but this keeps giving me a BSOD with IRQL_NOT_LESS_OR_EQUALLast scan with nod32 came up clean but still getting outbound connections and browser redirects.Looking to sort this out once and for all!DDS (Ver_10-03-17.... Read more

A:WinXP rootkit? problem + Win32/Olmarik.ZC Java/TrojanDownloader.Agent.NBE a variant of Win32/Olmarik.UL trojan Win32/Cimag.CL t...

Hi,Welcome to Bleeping Computer. My name is m0le and I will be helping you with your log.Please subscribe to this topic, if you haven't already. You can subscribe by clicking the Options box to the right of your topic title and selecting Track This Topic.Please avoid installing/uninstalling or updating any programs and attempting any unsupervised fixes or scans. This can make helping you impossible.Please reply to this post so I know you are there.The forum is busy and we need to have replies as soon as possible. If I haven't had a reply after 3 days I will bump the topic and if you do not reply by the following day after that then I will close the topic.----------------------------------------------Please download GMER from one of the following locations and save it to your desktop:Main MirrorThis version will download a randomly named file (Recommended)Zipped MirrorThis version will download a zip file you will need to extract first. If you use this mirror, please extract the zip file to your desktop.Disconnect from the Internet and close all running programs.Temporarily disable any real-time active protection so your security programs will not conflict with gmer's driver.Double-click on the randomly named GMER file (i.e. n7gmo46c.exe) and allow the gmer.sys driver to load if asked.Note: If you downloaded the zipped version, extract the file to its own folder such as C:\gmer and then double-click on gmer.exe.GMER will open to the Rootkit/Malware tab and perfor... Read more

Read other 14 answers
RELEVANCY SCORE 172

PLEASE NOTE: This is a DIFFERENT computer than the one I am currently working on with Agent ST

Because I was paranoid about this one, I ran an ESET Online scan to check my computer and it reported at several different trojans:

Win32/Toolbar.Zugo
2 variants of Win32/InstallCore.D
JS/Agent.NDJ
Win32/TrojanDownloader.Tracur.F
Java/Agent.DU
and probably a few more.

I am not sure exactly how many because I inadvertently closed Internet Explorer before the scan completed.

I did not set ESET to remove anything that was found, I was just scanning.

So, here I am,,,,needing help for yet another computer in my house.

It seems to be running fine but since this is the one I use for working at home, communicating with clients, online banking, etc. I need to be sure it's clean.

I am a web developer so I am very familiar with Windows,etc. however, virus removal is not my expertise so I need to ask for help.

Here is the contents of the DDS.log

.
DDS (Ver_2011-08-26.01) - NTFSx86
Internet Explorer: 8.0.6001.18702 BrowserJavaVersion: 10.2.0
Run by Dona at 15:35:19 on 2012-02-10
Microsoft Windows XP Professional 5.1.2600.3.1252.1.1033.18.3326.2232 [GMT -5:00]
.
AV: AVG Anti-Virus Free Edition 2011 *Disabled/Updated* {17DDD097-36FF-435F-9E1B-52D74245D6BF}
.
============== Running Processes ===============
.
C:\WINDOWS\system32\Ati2evxx.exe
C:\WINDOWS\system32\svchost -k DcomLaunch
svchost.exe
C:\WINDOWS\System32\svchost.exe -k nets... Read more

A:Need help with trojans..Win32/Toolbar.Zugo, Win32/InstallCore.D, JS/Agent.NDJ, Win32/TrojanDownloader.Tracur, Java/Agent.DU and...

Hi Dona!Peek a boo! Guess who?Can you try and zip up the GMER log file for me to review?---------------------Can you see if ESET Online Scanner dropped a log file in this location?Browse to this location: C:\Program Files\ESET\ESET Online Scanner\It should be named: log.txt if it was saved. If it is, please post that for me.---------------------You seem to have 2 versions of Skype installed. One of them seems to be a bit outdated.Lets remove that one now.You can go to the Control Panel and click on Add/Remove Programs and remove this one: Skype™ 4.1---------------------You're version of Firefox is also outdated by two versions. Open up Firefox and go to the Help menu click on About Firefox.It should check for updates, and download the updates that are required. Once it's completed downloading the update it'll present you with a button that says Apply Update. Please click on that. It will close Firefox and then apply the update to your computer.---------------------Please run these scans for me as well: Malwarebytes' Anti-Malware I see that you have Malwarebytes' Anti-Malware installed on your computer could you please do a scan using these settings: Open Malwarebytes' Anti-MalwareSelect the Update tabClick Check for UpdatesAfter the update have been completed, Select the Scanner tab.Select Perform quick scan, then click on ScanLeave the default options as it is and click on Start ScanWhen done, you will be pro... Read more

Read other 14 answers
RELEVANCY SCORE 170

It attacked IE first. I used Ad-Aware and CCleaner. It seemed to go away. Then it came back and attacked Firefox. I used Malwarebytes' Anti-Malware in conjunction with Ccleaner and it wouldn't go away. After every use, there would still be another DLL file to find and destroy, even if Malwarebytes' Anti-Malware said it was successful. Often the files that returned were different DLLs then before.I have no Window's Explorer due to this infection. Managed to run tasks anyway and found you guys on google when I entered in a DLL file name that I had originally found while scanning. I can't recall the name of the offending DLL... Ran the Kaspersky Scanner, and the Highjack This Scanner. All results are posted below. KASPERSKY ONLINE SCANNER 7 REPORTSaturday, December 6, 2008Operating System: Microsoft Windows XP Professional Service Pack 2 (build 2600)Kaspersky Online Scanner 7 version: 7.0.25.0Program database last update: Saturday, December 06, 2008 03:47:06Records in database: 1439820Scan settingsScan using the following database extendedScan archives yesScan mail databases yesScan area Critical AreasC:\Documents and Settings\All Users\Start Menu\Programs\StartupC:\Documents and Settings\Kienzle\Start Menu\Programs\StartupC:\Program FilesC:\WINDOWSScan statisticsFiles scanned 112172Threat name 2Infected objects 2Suspicious objects 0Duration of the scan 01:05:54File name Threat name Threats countC:\WINDO... Read more

A:Infected; Trojan.Win32.Agent.asjk, Trojan.Win32.Monder.aane

Hello! My name is Sam and I will be helping you. In order to see what's going on with your computer I may ask for you to post various logs from the tools that we will use to resolve your issue. Please also share with me any information about how your computer is reacting and behaving each step of the way as we work through this process.Please download ComboFix from one of these locations:Link 1Link 2Link 3Important!You should NOT use Combofix unless you have been instructed to do so by a Malware Removal Expert. It is intended by its creator to be used under the guidance and supervision of an Malware Removal Expert, not for private use.Using this tool incorrectly could lead to disastrous problems with your operating system such as preventing it from ever starting again. Make sure that you save ComboFix.exe to your DesktopDisable your AntiVirus and AntiSpyware applications, usually via a right click on the System Tray icon. They may otherwise interfere with our tools

Double click on ComboFix.exe & follow the prompts.

As part of it's process, ComboFix will check to see if the Microsoft Windows Recovery Console is installed. With malware infections being as they are today, it's strongly recommended to have this pre-installed on your machine before doing any malware removal. It will allow you to boot up into a special recovery/repair mode that will allow us to more easily help you should your computer have a problem after an attempted removal of malware.

Follow... Read more

Read other 19 answers
RELEVANCY SCORE 169.2

Hello,My name is Raj and I am a new member to this forum. Let me thank you, first of all, for all the help you all provide with solving these nasty issues. Now here is my situation.My problems started when my IE web pages did not load inspite of having good wireless connection. I ran AVG free and got the web browsing back. But then my CMD and regEdit tools would not work. I ran Spybot S&D but it did fix my issue. In addition my desktop stopped loading. I could use ctrl+alt+delete to get task manager and then use File -> Create New task to run explorer.exe. This would get my desktop back but only intermittently. Then I decided to buy Kaspersky. I was totally disappointed with it. It detected several malware but it could not cure Trojan-Clicker.win32.delf.cbe and Rootkit.win32.podnuha.a infections. It would try to delete these files, ask me to restart the computer and would not delete the files after the restart. Each time I restart the computer, it would detect these, try to delete, ask me to restart and the cycle continued. On top of the I lost my CMD and reggedit tools again. I tried to run dds.scr with the hope of getting you all the dds logs but my CMD tool does not work. In addtion whenever I tried to run 'cmd' I would lose my desktop (if I happend to get it back comehow).So instead of giving you attach.txt I can only give HT logs at this point. Hope you can help me out and I appreciate your help very much.ThanksRaj P.S : I could not attached the log... Read more

A:Trojan-Clicker.win32.delf.cbe and Rootkit.win32.podnuha.a infections

Hello! My name is Sam and I will be helping you. In order to see what's going on with your computer I will ask for you to post various logs from the tools that we will use to resolve your issue. Please also share with me any information about how your computer is reacting and behaving each step of the way as we work through this process.We need to create an OTListIt2 ReportPlease download OTListIt2 from hereSave it to your desktop.Double click on the icon on your desktop.Click the "Scan All Users" checkbox.Push the "Run Scan" button.The scan should take just a few minutes.Copy the log that opens up and paste it back here in your next reply.=============The next log will show us any hidden files that are present.Download GMER from here:Unzip it to the desktop.Open the program and click on the Rootkit tab.Make sure all the boxes on the right of the screen are checked, EXCEPT for ?Show All?.Click on Scan.When the scan has run click Copy and paste the results (if any) into this thread.

Read other 12 answers
RELEVANCY SCORE 169.2

It started two days ago. My Kaspersky detected a trojan intrusion win32.agent. I tried to delete it, but it just won't go away. It crashed a few times. today, I used the autoruns to remove the nonessential items comparing to the startup list. After, I used the spybo and adware to scan and clean it. all this time, my virus scan is going crazy trying to delete these two intrusions. but nothing has worked. I'm just about to give up and reinstall windows. Please Help....
Logfile of HijackThis v1.99.1
Scan saved at 0:31:11, on 2006-11-14
Platform: Windows XP SP2 (WinNT 5.01.2600)
MSIE: Internet Explorer v6.00 SP2 (6.00.2900.2180)

Running processes:
C:\WINDOWS\System32\smss.exe
C:\WINDOWS\system32\winlogon.exe
C:\WINDOWS\system32\services.exe
C:\WINDOWS\system32\lsass.exe
C:\WINDOWS\system32\svchost.exe
C:\WINDOWS\System32\svchost.exe
C:\Program Files\Intel\Wireless\Bin\EvtEng.exe
C:\Program Files\Intel\Wireless\Bin\S24EvMon.exe
C:\Program Files\Intel\Wireless\Bin\WLKeeper.exe
C:\Program Files\Intel\Wireless\Bin\ZcfgSvc.exe
C:\WINDOWS\system32\ctfmon.exe
C:\WINDOWS\system32\ZONELABS\vsmon.exe
C:\WINDOWS\Explorer.EXE
C:\WINDOWS\system32\spoolsv.exe
C:\Program Files\Kaspersky Lab\Kaspersky Anti-Virus 6.0\a... Read more

A:Trojan.win32.startpage.amg&trojan-downloader.win32.agent.bbc

Hi and welcome to Bleeping Computer! My name is Sam and I will be helping you. Please download ComboFix and save it to your desktop.Double click combofix.exe and follow the prompts.When it's done running it will produce a log for you. Please post that log in your next reply.Important Note - Do not mouseclick combofix's window whilst it's running. That may cause it to stall.

Read other 2 answers
RELEVANCY SCORE 169.2

I have followed all the preparation steps before posting, but am still getting a variety of Windows Security Alerts popups about Trojans . First was Trojan-Downloader.Win32.Agent.bq, and then Trojan-Spy.Win32.GreenScreen, and the latest is a Windows Security Alerts popup with sort of a section of a screen shot of a verizon yahoo search results page for antispyware-review.Running Windows XP on a Pentium PC DesktopHJT log:Logfile of Trend Micro HijackThis v2.0.2Scan saved at 1:44:57 PM, on 9/13/2008Platform: Windows XP SP3 (WinNT 5.01.2600)MSIE: Internet Explorer v7.00 (7.00.6000.16705)Boot mode: NormalRunning processes:C:\WINDOWS\System32\smss.exeC:\WINDOWS\system32\winlogon.exeC:\WINDOWS\system32\services.exeC:\WINDOWS\system32\lsass.exeC:\WINDOWS\system32\svchost.exeC:\WINDOWS\System32\svchost.exeC:\Program Files\Lavasoft\Ad-Aware\aawservice.exeC:\WINDOWS\Explorer.EXEC:\WINDOWS\system32\LEXBCES.EXEC:\WINDOWS\system32\LEXPPS.EXEC:\WINDOWS\system32\spoolsv.exeC:\WINDOWS\system32\dllhost.exeC:\Program Files\Google\Common\Google Updater\GoogleUpdaterService.exeC:\WINDOWS\sm56hlpr.exeC:\WINDOWS\system32\tcpsvcs.exeC:\WINDOWS\system32\SearchIndexer.exeC:\Program Files\BroadJump\Client Foundation\CFD.exeC:\Program Fi... Read more

A:Trojan-downloader.win32.agent.bq, Trojan-spy.win32.greenscreen, Etc.

Hello and welcome to BCApologize for the delay in response we get overwhelmed at times but we are trying our best to keep up.If you have since resolved the original problem you were having would appreciate you letting us know If not please perform the following below so we can have a look at the current condition of your machine.Upon completing the steps below a staff member will review and take the steps necessary with you to get your machine back in working order clean and free of malware.Thanks and again sorry for the delay.Download random's system information tool (RSIT) by random/random from here and save it to your desktop.Double click on RSIT.exe to run RSIT.
Note: If you are using Windows Vista, right click at RSIT.exe and select 'Run as administrator'.

Click Continue at the disclaimer screen.Once it has finished, two logs will open. Please post the contents of both log.txt (<<will be maximized) and info.txt (<<will be minimized)NextPlease do a scan with Kaspersky Online ScannerNote: If you are using Windows Vista, open your browser by right-clicking on its icon and select 'Run as administrator' to perform this scan.Click on the Accept button and install any components it needs.The program will install and then begin downloading the latest definition files.After the files have been downloaded on the left side of the page in the Scan section select My ComputerThis will start the program and scan your system.The scan will take a while, so be patient and le... Read more

Read other 3 answers
RELEVANCY SCORE 168.4

Cleaning up my sister's computer (Vista), I ran Spybot Search & Destroy and along with the usual cookies, it said it found Win32.Agent.ieu, Zlob.Downloader.rid, and Win32.FraudLoad. After 'fixing' these, I checked and saw that Windows Firewall was disabled. When I tried to restore the defaults, it wouldn't work. Of course this may be unrelated. I restarted and ran another Spybot scan, and found Win32.Agent.ieu and Zlob.Downloader.rid again, and removed them again. This time when I tried to re-enable the Windows Firewall defaults, it worked. About the same time I was doing this, my sister discovered someone had hijacked their PayPal account and made a large purchase... this may also be unrelated, but I suppose it's possible the malware snagged their login info. At this point I decided it was time to call in the cavalry to make sure this malware was completely gone. I couldn't get GMER to run. After starting the scan, I got a blue screen / restart twice in a row. Your help in clearing this off is appreciated!DDS (Ver_10-03-17.01) - NTFSx86 Run by Chris & Kait at 12:57:21.69 on Fri 04/30/2010Internet Explorer: 8.0.6001.18904 BrowserJavaVersion: 1.6.0_20Microsoft? Windows Vista? Home Premium 6.0.6002.2.1252.1.1033.18.1022.176 [GMT -5:00]SP: Spybot - Search and Destroy *disabled* (Updated) {ED588FAF-1B8F-43B4-ACA8-8E3C85DADBE9}SP: Windows Defender *disabled* (Updated) {D68DDC3A-831F-4FAE-9E44-DA132C1ACF46}============== Running Processes ====... Read more

A:Triple infection: Win32.Agent.ieu, Zlob.Downloader.rid, and Win32.FraudLoad

Hello and welcome to Bleeping ComputerWe apologize for the delay in responding to your request for help. Here at Bleeping Computer we get overwhelmed at times, and we are trying our best to keep up. Please note that your topic was not intentionally overlooked. Our mission is to help everyone in need, but sometimes it takes just a little longer to get to every request for help. No one is ignored here.If you have since resolved the original problem you were having, we would appreciate you letting us know. If not please perform the following steps below so we can have a look at the current condition of your machine. If you have not done so, include a clear description of the problems you're having, along with any steps you may have performed so far.Upon completing the steps below another staff member will review and take the steps necessary with you to get your machine back in working order clean and free of malware.If you have already posted a DDS log, please do so again, as your situation may have changed.Use the 'Add Reply' and add the new log to this thread.Thanks and again sorry for the delay.We need to see some information about what is happening in your machine. Please perform the following scan:Download DDS by sUBs from one of the following links. Save it to your desktop.DDS.scrDDS.pifDouble click on the DDS icon, allow it to run.A small box will open, with an explaination about the tool. No input is needed, the scan is running.Notepad will open with the results.Foll... Read more

Read other 2 answers
RELEVANCY SCORE 167.2

i am sorry to post a log over here, as i have read through the forum and try to resolve the problem on my own but i failed.since i had ran the comboFix, so i feel that it may be of help to post it.sorry for the trouble..here's the log file...ComboFix 09-07-28.06 - Bentley 07/30/2009 0:35.1.8 - NTFSx86Microsoft? Windows Vista? Ultimate 6.0.6001.1.1252.1.1033.18.3069.1872 [GMT 8:00]Running from: c:\users\Bentley\Desktop\ComboFix.exeSP: SUPERAntiSpyware *disabled* (Updated) {222A897C-5018-402e-943F-7E7AC8560DA7}SP: Windows Defender *enabled* (Updated) {D68DDC3A-831F-4FAE-9E44-DA132C1ACF46} * Created a new restore point.((((((((((((((((((((((((((((((((((((((( Other Deletions ))))))))))))))))))))))))))))))))))))))))))))))))).c:\windows\Install.txtc:\windows\system32\tmp0_144047822718.bkc:\windows\system32\tmp0_16962678345.bkc:\windows\system32\tmp0_205418834021.bkc:\windows\system32\tmp0_355351885288.bkc:\windows\system32\tmp0_424346226483.bkc:\windows\system32\tmp0_516880812123.bkc:\windows\system32\tmp0_517948877969.bkc:\windows\system32\tmp0_525286544717.bkc:\windows\system32\tmp0_687442396617.bkc:\windows\system32\tmp0_77071886817.bkc:\windows\system32\tmp0_779592338841.bkc:\windows\system32\tmp0_790261416358.bkc:\windows\system32\tmp2_1075327197... Read more

A:Infected with win32/rootkit.agent.ODG trojan and win32/Olmarik.JU trojan

Hello and welcome to Bleeping ComputerWe apologize for the delay in responding to your request for help. Here at Bleeping Computer we get overwhelmed at times, and we are trying our best to keep up. Please note that your topic was not intentionally overlooked. Our mission is to help everyone in need, but sometimes it takes just a little longer to get to every request for help. No one is ignored here.If you have since resolved the original problem you were having, we would appreciate you letting us know. If not please perform the following steps below so we can have a look at the current condition of your machine. If you have not done so, include a clear description of the problems you're having, along with any steps you may have performed so far.Upon completing the steps below another staff member will review and take the steps necessary with you to get your machine back in working order clean and free of malware.If you have already posted a DDS log, please do so again, as your situation may have changed.Use the 'Add Reply' and add the new log to this thread.Thanks and again sorry for the delay.We need to see some information about what is happening in your machine. Please perform the following scan:Download DDS by sUBs from one of the following links. Save it to your desktop.DDS.scrDDS.pifDouble click on the DDS icon, allow it to run.A small box will open, with an explaination about the tool. No input is needed, the scan is running.Notepad will open with the results.Foll... Read more

Read other 2 answers
RELEVANCY SCORE 167.2

My computer has been infected with Win32/Rootkit.Agent.ODG trojan and Win32/Olmarik.JU trojan. AVG, ESET NOD32, and Avira couldn't delete it, and I want to delete it. It redirected all Google searches and slows down my computer. Can you please help me. Thanks ahead to anyone who can help.Here is the HJT logfile:Logfile of Trend Micro HijackThis v2.0.2Scan saved at 2:28:51 PM, on 18/08/2009Platform: Windows XP SP3 (WinNT 5.01.2600)MSIE: Internet Explorer v8.00 (8.00.6001.18702)Boot mode: NormalRunning processes:C:\WINDOWS\System32\smss.exeC:\WINDOWS\system32\winlogon.exeC:\WINDOWS\system32\services.exeC:\WINDOWS\system32\lsass.exeC:\WINDOWS\system32\Ati2evxx.exeC:\WINDOWS\system32\svchost.exeC:\Program Files\Windows Defender\MsMpEng.exeC:\WINDOWS\System32\svchost.exeC:\WINDOWS\system32\svchost.exeC:\WINDOWS\system32\ZoneLabs\vsmon.exeC:\Program Files\CheckPoint\ZAForceField\IswSvc.exeC:\WINDOWS\system32\LEXBCES.EXEC:\WINDOWS\system32\spoolsv.exeC:\WINDOWS\system32\LEXPPS.EXEC:\WINDOWS\Explorer.EXEC:\Program Files\Avira\AntiVir Desktop\sched.exeC:\Program Files\Avira\AntiVir Desktop\avguard.exeC:\Program Files\Common Files\Apple\Mobile Device Support\bin\AppleMobileDeviceService.exeC... Read more

A:Infected with Win32/Rootkit.Agent.ODG trojan and Win32/Olmarik.JU trojan

Hello and to Bleeping ComputerWe apologize for the delay in responding to your request for help. Here at Bleeping Computer we get overwhelmed at times, and we are trying our best to keep up. Please note that your topic was not intentionally overlooked. Our mission is to help everyone in need, but sometimes it takes just a little longer to get to every request for help. No one is ignored here.If you have since resolved the original problem you were having, we would appreciate you letting us know. If not please perform the following steps below so we can have a look at the current condition of your machine. If you have not done so, include a clear description of the problems you're having, along with any steps you may have performed so far.Upon completing the steps below another staff member will review and take the steps necessary with you to get your machine back in working order clean and free of malware.If you have already posted a DDS log, please do so again, as your situation may have changed.Use the 'Add Reply' and add the new log to this thread.Thanks and again sorry for the delay.-----------------------------------------------------------We need to see some information about what is happening in your machine. Please perform the following scan:Download DDS by sUBs from one of the following links. Save it to your desktop.DDS.scrDDS.pifDouble click on the DDS icon, allow it to run.A small box will open, with an explaination about the tool. No input is needed, ... Read more

Read other 20 answers
RELEVANCY SCORE 166.4

HI all! - I'll try to make a long story short and want to thank whoever reaches out to me for assistance in advance. I attempted to download a video driver by mistake and it ended up being the above named Trojan that quickly infected my computer and bty I'm far from a computer expert so I appreciate your patience, I think I have it or most of it removed as I cannot find it anywhere but I now have a very slow running computer, I called Mediacom and they said that my upload is way higher than my download speeds, I normally get around 15mg down and 1.5m up but now it's 900kbs down and still 1.5mg up so the guy at Mediacom told me that I may have a spy ware or some type of bug that is trying to pull info from my pc. I have the free versions of Ad-Aware, Avira, CCleaner and Spy hunter which won't remove anything until I purchase which is fine, I guess my point is I want to spend my $50 on the best and most effective remover that will work and need help identifying the actual problem. The above-mentioned programs are not working. Again, thank you in advance for any help you can provide! Also, here is a link I went to to get help but nothing on here helped or I didn?t do it right; http://www.spywareremove.com/removeTrojanC...Win32Tinyh.htmlHere's what showed up in the registry from SpyHunter; Zlob Trojan - HitBox (Spyware cookie) - Trojan Puper - PurityScan - IST Bar - Webhancer - Media Access - 2o7 -Advert - Sixty Six Pop up

A:HELP! Trojan-Clicker.Win32.Tiny.h

Hello please run a S!Ri's SmitfraudFix and MBAM scan.SmitFraudFixCopy and paste the contents of the report in your next reply The report can be found at the root of the system drive, usually at C:\rapport.txt Please download Malwarebytes Anti-Malware and save it to your desktop.Make sure you are connected to the Internet.Double-click on mbam-setup.exe to install the application.When the installation begins, follow the prompts and do not make any changes to default settings.When installation has finished, make sure you leave both of these checked:Update Malwarebytes' Anti-MalwareLaunch Malwarebytes' Anti-MalwareThen click Finish.MBAM will automatically start and you will be asked to update the program before performing a scan. If an update is found, the program will automatically update itself. Press the OK button to close that box and continue. If you encounter any problems while downloading the updates, manually download them from here and just double-click on mbam-rules.exe to install.On the Scanner tab:Make sure the "Perform Quick Scan" option is selected.Then click on the Scan button.If asked to select the drives to scan, leave all the drives selected and click on the Start Scan button. The scan will begin and "Scan in progress" will show at the top. It may take some time to complete so please be patient.When the scan is finished, a message box will say "The scan completed successfully. Click 'Show Results' to display ... Read more

Read other 10 answers
RELEVANCY SCORE 166.4

can comeone please help me
my computer is getting the train ran on it....i keep getting these popups

Trojan-Clicker.Win32.Tiny.h
Trojan-Downloader.Win32.Agent.bq
Trojan-Spy.HTML.Bankfraud.dq
Trojan-Spy.Win32.KeyLogger.aa

i need ot get ride of these, please someone help...
im running windows vista, and i have mcafee antivirus and superantispyware, neither can fix the problem.........

please help me
 

Read other answers
RELEVANCY SCORE 166.4

Spybot Search & Destroy found win32.agent.sd, win32.tdss.rtk, and zlob.downloader.bit. I removed them successfully, yet my computer is still running incredibly sluggish. When I go to Control Panel>Security Center>Virus Protection, it says VirusRescue3.0 is up to date. I have no idea what Virus Rescue is. Also, when i go to My Computer>C: it gives me the following error message: "windows cannot find resycled\boot.com. Make sure you typed the name correctly and try again. To search for a file, click the Start button, then click Search.

Here is my HiJackThis log:

Logfile of Trend Micro HijackThis v2.0.2
Scan saved at 10:52:07 PM, on 10/19/2009
Platform: Windows XP SP3 (WinNT 5.01.2600)
MSIE: Internet Explorer v7.00 (7.00.6000.16915)
Boot mode: Normal

Running processes:
C:\WINDOWS\System32\smss.exe
C:\WINDOWS\system32\winlogon.exe
C:\WINDOWS\system32\services.exe
C:\WINDOWS\system32\lsass.exe
C:\WINDOWS\system32\svchost.exe
C:\WINDOWS\System32\svchost.exe
C:\WINDOWS\system32\LEXBCES.EXE
C:\WINDOWS\system32\spoolsv.exe
C:\WINDOWS\system32\LEXPPS.EXE
C:\WINDOWS\ehome\ehtray.exe
C:\WINDOWS\System32\DLA\DLACTRLW.EXE
C:\WINDOWS\system32\igfxpers.exe
C:\Program Files\Dell AIO Printer A940\dlbabmgr.exe
C:\Program Files\Java\jre6\bin\jusched.exe
C:\Program Files\Dell AIO Printer A940\dlbabmon.exe
C:\WINDOWS\system32\ctfmon.exe
C:\Program Files\Spybot - Search & Destroy\TeaTimer.exe
C:\WINDOWS\eHome\ehRecvr.exe
C:\WINDOWS\eHome\ehSched.exe
C:\Program Files\Java\jr... Read more

A:win32.agent.sd, win32.tdss.rtk, zlob.downloader.bit

Read other 16 answers
RELEVANCY SCORE 164.4

I found out i am infected of Trojan-Downloader.Win32.Agent.zdo. Please help don't know how to remove from my laptop. My antivirus was Norton antivurs not able to detect it but Kapersky online scan did.

A:Infected With Trojan-downloader.win32.agent.zdo

I have already responded in your other thread here. Please do not start new threads or duplicate topics as this causes confusion and makes it more difficult to get the help you need to resolve your issues. Thanks for your cooperation.This thread is closed. If you have any questions. Please PM me or another Moderator.

Read other 1 answers
RELEVANCY SCORE 164.4

Symptoms:Background replaced with spyware notification."Windows Security Alert" pops up periodically saying that a windows firewall has detected activity of harmful software"Enable protection link" to spyware removal program.Bit Defender (housecall had problems with download)McAfee StingerAlso known as Trojan-Spy.HTML.Bankfraud.dqI have run:AdawareSpybotCleaned temp filesLogfile of Trend Micro HijackThis v2.0.2Scan saved at 8:04:06 AM, on 8/24/2008Platform: Windows Vista SP1 (WinNT 6.00.1905)MSIE: Internet Explorer v7.00 (7.00.6001.18000)Boot mode: NormalRunning processes:C:\Windows\system32\taskeng.exeC:\Windows\system32\Dwm.exeC:\Windows\Explorer.EXEC:\Program Files\Windows Defender\MSASCui.exeC:\Program Files\Synaptics\SynTP\SynTPEnh.exeC:\Program Files\Hewlett-Packard\HP Quick Launch Buttons\QLBCTRL.exeC:\Program Files\Java\jre1.6.0\bin\jusched.exeC:\Program Files\iTunes\iTunesHelper.exeC:\Program Files\Hp\HP Software Update\hpwuSchd2.exeC:\Program Files\Hewlett-Packard\HP Wireless Assistant\HPWAMain.exeC:\Program Files\Hp\QuickPlay\QPService.exeC:\Windows\System32\rundll32.exeC:\Program Files\Windows Sidebar\sidebar.exeC:\Program Files\Hewlett-Packard\HP Advisor\HPAdvisor.exeC:\Program Files\Windows M... Read more

A:Infected With Trojan-downloader.win32.agent.bq

Hello Blue97 and welcome to BleepingComputer,1. * Clean your Cache and Cookies in IE:Close all instances of Outlook Express and Internet Explorer Go to Control Panel > Internet Options > General tabUnder Browsing History, click Delete. Click Delete Files, Delete cookies and Delete historyClick Close below.* Clean your Cache and Cookies in Firefox (In case you also have Firefox installed):Go to Tools > Options.Click Privacy in the menu..Click the Clear now button below.. A new window will popup what to clear.Select all and click the Clear button again.Click OK to close the Options window* Clean other Temporary files + Recycle bin Go to start > run and type: cleanmgr and click ok. Let it scan your system for files to remove. Make sure Temporary Files, Temporary Internet Files, and Recycle Bin are the only things checked.Press OK to remove them.2. Please download Malwarebytes' Anti-Malware from Here or HereDoubleclick mbam-setup.exe to install the application.Make sure a checkmark is placed next to Update Malwarebytes' Anti-Malware and Launch Malwarebytes' Anti-Malware, then click Finish.If an update is found, it will download and install the latest version.Once the program has loaded, select "Perform Quick Scan", then click Scan.The scan may take some time to finish,so please be patient.When the scan is complete, click OK, then Show Results to view the results.Make sure that everything is checked, and click Remove Selected.When disinfection is completed,... Read more

Read other 13 answers
RELEVANCY SCORE 164.4

Hello and thanks in advance for your help.I've been looking through the different forums to see if I can find any "fixes" on my own but then realized...it's probably best to leave it to the experts! So here are the details...1. The other day Avast informed me that a site I was visiting was infected with "JS:Downloader-JA[Trj]" and that it moved to the "Chest." I opened Avast and noticed that 2 others "viruses" were in there as well...JS:Agent-AV[Trj] and Win32:Trojan-gen{other}.2. After that I tried to run MBAM but it didn't work. I recieved 2 error messages... 1. VbAccelerator SGrid11 Control Run.time Error '0' 2. Run-time Error '440' Automation Error3. When MBAM didn't work I attempted to come to the BC site but IE said "No Connection" or it wouldn't load. So I shut down and restarted again.4. Since getting the notification of the first virus, when I close my Office Email and Calendar the icons still show in the "Notifications Area" and they are still active in the processes tab of the Task Mgr.5. I have used CCleaner in the past to clean up my computer and uninstall programs but have noticed recently each time I use it, and on the next reboot, my computer completely freezes where only the mouse works. Also, on the "blue ball" for Avast, there is a "red circle with a line through it." The only way to "unfreeze&quo... Read more

A:Infected with JS:Downloader-JA[Trj] and JS:Agent-AV[Trj] and Win32;Trojan-gen{other}???

Hello and welcome to Bleeping ComputerWe apologize for the delay in responding to your request for help. Here at Bleeping Computer we get overwhelmed at times, and we are trying our best to keep up. Please note that your topic was not intentionally overlooked. Our mission is to help everyone in need, but sometimes it takes just a little longer to get to every request for help. No one is ignored here.If you have since resolved the original problem you were having, we would appreciate you letting us know. If not please perform the following steps below so we can have a look at the current condition of your machine. If you have not done so, include a clear description of the problems you're having, along with any steps you may have performed so far.Upon completing the steps below another staff member will review and take the steps necessary with you to get your machine back in working order clean and free of malware.If you have already posted a DDS log, please do so again, as your situation may have changed.Use the 'Add Reply' and add the new log to this thread.Thanks and again sorry for the delay.We need to see some information about what is happening in your machine. Please perform the following scan:Download DDS by sUBs from one of the following links. Save it to your desktop.DDS.scrDDS.pifDouble click on the DDS icon, allow it to run.A small box will open, with an explaination about the tool. No input is needed, the scan is running.Notepad will open with the results.Foll... Read more

Read other 25 answers
RELEVANCY SCORE 164.4

Ok, so the problem started yesterday. Got to a website I didn't want to be in, and bam, the ads starting popping and I started getting popups by "Windows Firewall". I got one at first, but I started getting many different varieties. The first I got was the Trojan-clicker.win32.tiny.h. After that I got win32.greenscreen, .keylogger.aa, trojan-downloader.win32.agent.bq, trojan-spy.html.bankfraud.dq. All of these have come up as a "Windows Security Alert" as a "Critical" risk. And they continue to periodically popup.

I don't know if that's the virus itself, or actually the windows firewall.

I've gone through some of the steps listed. I tried to do PandaActivescan, but it took 5.5 hrs and when it finished, my computer froze (it was mostly frozen throughout the process, except for firefox which still ran the scan). It picked up 33 viruses/spyware, but I was not able to disinfect (it only would let me disinfect 1 anyway). There were 2 vulnerabilities detected; I think one was high-risk.

After that I decided to turn off the power and restart. There was some mention about a disk, but I said cancel, and it allowed windows to startup. I decided to go ahead and do the next step (I wasn't able to get a log of the Pandascan). I got Spyware Blaster and IE-Spyad installed, but I haven't been able to get any windows updates installed. Usually it appears on my taskbar, but it hasn't now.

I hope that is helpful. I have run Hijack-this, but apparentl... Read more

A:Trojan-clicker.win32.tiny.h....and many other varieties

BUMP. It's been 3.5 days, I could reallllly use some help!!

Some stuff before I post my Hijack this log:

There were some prgrms that I had to "end task" on the last time I shut down my computer: gjyxixsr.exe, prun.exe, SuperMWindow. I'm not sure these are great programs.

Also, whenever I start my computer, I get a window that says "Window- No Disk" "Exception processing message c0000013 parameters 75b6bf9c 75b6bf9c 75b6bf9c"

Not sure what that means

Anyway, My HijackThis log for today (please help!!!):


Logfile of Trend Micro HijackThis v2.0.2
Scan saved at 6:55:48 PM, on 10/6/2008
Platform: Windows XP SP2 (WinNT 5.01.2600)
MSIE: Internet Explorer v6.00 SP2 (6.00.2900.2180)
Boot mode: Normal

Running processes:
C:\WINDOWS\System32\smss.exe
C:\WINDOWS\system32\winlogon.exe
C:\WINDOWS\system32\services.exe
C:\WINDOWS\system32\lsass.exe
C:\WINDOWS\system32\svchost.exe
C:\WINDOWS\System32\svchost.exe
C:\WINDOWS\Explorer.EXE
C:\Program Files\Common Files\Symantec Shared\ccSvcHst.exe
C:\Program Files\Common Files\Symantec Shared\AppCore\AppSvc32.exe
C:\WINDOWS\system32\LEXBCES.EXE
C:\WINDOWS\system32\spoolsv.exe
C:\Program Files\Symantec\LiveUpdate\ALUSchedulerSvc.exe
C:\Program Files\Common Files\Symantec Shared\ccSvcHst.exe
C:\WINDOWS\system32\drivers\KodakCCS.exe
C:\WINDOWS\System32\nvsvc32.exe
C:\Program Files\CyberLink\Shared Files\RichVideo.exe
C:\WINDOWS\System32\svchost.exe
C:\Documents and Settings\Al... Read more

Read other 19 answers
RELEVANCY SCORE 164.4

Hi, I posted before but I'm gonna be more specific this time. I downloaded the Xp Antivirus 2008 spyware and my screen went blue with the jokebluescreen-c virus. I think I cleared it all but don't know if some of it is still hiding. Here is my HijackThis log:

Logfile of Trend Micro HijackThis v2.0.2
Scan saved at 11:46:57 PM, on 7/31/2008
Platform: Windows XP SP2 (WinNT 5.01.2600)
MSIE: Internet Explorer v7.00 (7.00.6000.16674)
Boot mode: Normal

Running processes:
C:\WINDOWS\System32\smss.exe
C:\WINDOWS\system32\winlogon.exe
C:\WINDOWS\system32\services.exe
C:\WINDOWS\system32\lsass.exe
C:\WINDOWS\system32\svchost.exe
C:\WINDOWS\System32\svchost.exe
C:\WINDOWS\system32\spoolsv.exe
C:\Program Files\Creative\Shared Files\CTAudSvc.exe
C:\PROGRA~1\McAfee\MSC\mcmscsvc.exe
c:\PROGRA~1\COMMON~1\mcafee\mna\mcnasvc.exe
c:\PROGRA~1\COMMON~1\mcafee\mcproxy\mcproxy.exe
C:\Program Files\McAfee\VirusScan\McShield.exe
C:\Program Files\Common Files\Microsoft Shared\VS7DEBUG\MDM.EXE
C:\Program Files\McAfee\MPF\MPFSrv.exe
C:\WINDOWS\system32\nvsvc32.exe
C:\Program Files\Anonymizer\Anonymizer Software\AnonASW\AnonAswSvc.exe
C:\Program Files\Anonymizer\Anonymizer Software\Common\AnonMgmtSvc.exe
c:\PROGRA~1\mcafee.com\agent\mcagent.exe
C:\WINDOWS\Explorer.EXE
C:\WINDOWS\System32\svchost.exe
C:\Program Files\Java\jre1.6.0_06\bin\jusched.exe
C:\Program Files\Creative\Shared Files\Module Loader\DLLML.exe
C:\Program Files\Creative\Sound Blaster X-Fi\DVDAudio\CTDVDDET.EXE
C:\Program Files\... Read more

A:Please help Trojan-clicker.win32.tiny.h/jokebluescreen-c

bump
 

Read other 2 answers
RELEVANCY SCORE 164.4

I just recently got this message on my computer...and it essentially shut up off and rebooted and when it came back up i got what looked like a legitimate message saying
system alert your computer is infected
it is recommended that you use special antispyware tool to PERVENT data loss. Windows will now download and install the most up-to-date antispyware for you.
click here to protect your computer from spyware.

I also get this message...

&#8220;Windows Security Alert To help protect your computer, Windows Firewall has detected activity of harmful software. Do you want to block this software from sending data over the internet?

I cannot find it anywhere...as soon as i got this i ran adware by lavasoft and it found it and removed it but yet im still getting the messages....please help!!

OH yeah its windows XP home
 

A:Solved: Hello all...Trojan-Clicker.Win32.Tiny.h

Read other 16 answers
RELEVANCY SCORE 164.4

Please guide me through the process of removing this trojan.I keep getting fake windows firewall alerts as pop ups of a trojan attack Trojan-Clicker.Win32.Tiny.h and many more such names likeTrojan-clicker.win32.tiny.hTrojan-downloader.win32.agent.bqTrojan-spy.win32.keylogger.aaTrojan-spy.win32.GreenScreenTrojan-spy.HTML.Bankfraud.dqRepeated Full system scans (each time restarting the system ) by the following s/w ahve not helped.SUPERAntiSpywareMacafee on demand scanMalwareBytes' Anti MalwareAd-aware 2008cleaned temp files with cleanmgr Please help me remove these pop ups that i get.Below is the log of the last scan i did with Ad-AwareAd-Aware Build Log File Created on: 2008-08-22 16:54:36Using Definitions File: C:\Documents and Settings\All Users\Application Data\Lavasoft\Ad-Aware\core.aawdefComputer name: STPLT130Name of user performing scan: SYSTEMSystem information===========================Number of processors: 2Processor type: Genuine Intel® CPU T2300 @ 1.66GHzMemory Available: 36%Total Physical Memory: 2137112576 BytesAvailable Physical Memory: 769224704 BytesTotal Page File Size: 4121980928 BytesAvailable On Page File: 2398314496 BytesTotal Virtual Memory: 2147352576 BytesAvailable Virtual Memory: 1750691840 BytesOS: Microsoft Windows XP Service Pack 2 (Build 2600) Ad-Aware Settings===========================Skipping files larger than 1048576 kB Ignoring infections with lower TAI than: 3Extended Ad-Aware Settings=====... Read more

A:Trojan-clicker.win32.tiny.h And Other Unstopping Pop Ups

Rescan again with MBAM (Quick Scan) in normal mode and check all items found for removal. Don't forgot to reboot afterwards. Failure to reboot normally (not into safe mode) will prevent MBAM from removing all the malware. When done, click the Logs tab and copy/paste the contents of the new report in your next reply along with the results of the previous log.

Read other 7 answers
RELEVANCY SCORE 164.4

Every few minutes, I get a different Windows Security Alert popup notifying me that my firewall has detected activity of harmful software. The names on the popup alerts are as follows:

Trojan-Clicker.Win32.Tiny.h
Trojan-Spy.Win32.KeyLogger
Trojan-Spy.Win32.GreenScreen
Trojan-Spy.HTML.BankFraud.dq
Trojan-DownLoader.Win32.Agent.bq

When I click on the available popup action, it takes me to a spammer site (http://www.antispyware-review.biz/). I ran Ad-Aware (the free version) and it found/quarantined a couple Trojans, but didnít take care of the popups.

Iíve read a similar post of an infected PC and realize that there are several steps in identifying the correct files and registry entries, which may be unique in each instance.

Below Iíve included my HijackThis log and HiJackThis Uninstall List. The ComboFix.txt file will be sent in a subsequent post since I've exceeded the character length in this post.

Iíd appreciate your help in walking me through the process!

---------------------------
Here is my HiJackThis log
---------------------------
Logfile of Trend Micro HijackThis v2.0.2
Scan saved at 10:10:28 AM, on 10/21/2008
Platform: Windows XP SP2 (WinNT 5.01.2600)
MSIE: Internet Explorer v7.00 (7.00.6000.16735)
Boot mode: Normal
Running processes:
C:\WINDOWS\System32\smss.exe
C:\WINDOWS\system32\winlogon.exe
C:\WINDOWS\system32\services.exe
C:\WINDOWS\system32\lsass.exe
C:\WINDOWS\system32\svchost.exe
C:\WINDOWS\System32\svchost.exe
C:\Program Files\Lavasoft\Ad-A... Read more

Read other answers
RELEVANCY SCORE 164.4

Hi, I have been infected. I have run AVG, adAware, super anti spyware spyboy, pestpatrol and nothing seems to help get rid of this one. Please help. Here is my HJT log. Thanks in advance.

Logfile of Trend Micro HijackThis v2.0.2
Scan saved at 10:50:54 PM, on 10/10/2008
Platform: Windows XP SP2 (WinNT 5.01.2600)
MSIE: Internet Explorer v6.00 SP2 (6.00.2900.2180)
Boot mode: Normal

Running processes:
C:\WINDOWS\System32\smss.exe
C:\WINDOWS\system32\winlogon.exe
C:\WINDOWS\system32\services.exe
C:\WINDOWS\system32\lsass.exe
C:\WINDOWS\system32\svchost.exe
C:\WINDOWS\System32\svchost.exe
C:\WINDOWS\system32\spoolsv.exe
C:\Program Files\Common Files\Apple\Mobile Device Support\bin\AppleMobileDeviceService.exe
C:\PROGRA~1\AVG\AVG8\avgwdsvc.exe
C:\Program Files\Bonjour\mDNSResponder.exe
C:\Program Files\Google\Common\Google Updater\GoogleUpdaterService.exe
C:\Program Files\Alcohol Soft\Alcohol 120\StarWind\StarWindServiceAE.exe
C:\WINDOWS\system32\svchost.exe
C:\Program Files\Viewpoint\Common\ViewpointService.exe
C:\WINDOWS\system32\MsPMSPSv.exe
C:\Program Files\Compact Wireless-G USB Network Adapter with SpeedBooster\WLService.exe
C:\Program Files\Compact Wireless-G USB Network Adapter with SpeedBooster\WUSB54GSC.exe
C:\PROGRA~1\AVG\AVG8\avgrsx.exe
C:\PROGRA~1\AVG\AVG8\avgemc.exe
C:\WINDOWS\Explorer.EXE
C:\Documents and Settings\All Users\Application Data\gjinqnuh\oribmfsn.exe
C:\Program Files\Analog Devices\SoundMAX\SMax4PNP.exe
C:\Program Files\Analog Devices\SoundMAX\Smax4.exe
... Read more

Read other answers