Over 1 million tech questions and answers.

Infected With Win32:alphabet-b Trojan

Q: Infected With Win32:alphabet-b Trojan

Hello All ive just registered as a member 1st time im posting. Please help, this morning i updated Avast anti-virus and it ran a scan of system and found alphabet-b trojan on system. Ive tried attempting to delete but what seems to be happpening is it continues to find the virus continuesly with random numbers as a file name from my documents & setting/local/temp folder. everytime it has been found im quarinteing them. this forums been a great help. so far ive downloaded hijack, sdfix,combofix and downloaded and run ccleaner which has cleared all temp files from internet explorer and mozilla even the system temp files. still cant get rid of the trojan. can someone take a look at the hijack scan and tell me what i should be deleting. the lines in bold is what i believe i should get rid of. thanks in advance Logfile of HijackThis v1.99.1Scan saved at 16:20:19, on 01/07/2007Platform: Windows 2003 SP2 (WinNT 5.02.3790)MSIE: Internet Explorer v6.00 SP1 (6.00.3790.1830)Running processes:D:\Program Files\Alwil Software\Avast4\aswUpdSv.exeD:\Program Files\Alwil Software\Avast4\ashServ.exeC:\Program Files (x86)\Common Files\Ahead\Lib\NMBgMonitor.exeC:\Program Files (x86)\Analog Devices\Core\smax4pnp.exeC:\Program Files (x86)\Analog Devices\SoundMAX\Smax4.exeC:\Program Files (x86)\ATI Technologies\ATI.ACE\CLI.EXED:\PROGRA~2\ALWILS~1\Avast4\ashDisp.exeC:\WINDOWS\avp.exeC:\Documents and Settings\All Users\Application Data\szarkrmf.exeD:\Program Files\Alwil Software\Avast4\ashMaiSv.exeD:\Program Files\Alwil Software\Avast4\ashWebSv.exeC:\Program Files (x86)\Common Files\Ahead\Lib\NMIndexingService.exeC:\Program Files (x86)\Common Files\Ahead\Lib\NMIndexStoreSvr.exeC:\Program Files (x86)\ATI Technologies\ATI.ACE\cli.exeC:\Program Files (x86)\ATI Technologies\ATI.ACE\cli.exeH:\Combat_Virus&Trojans\HijackThis\HijackThis.exeC:\Program Files (x86)\Mozilla Firefox\firefox.exeC:\WINDOWS\system32\notepad.exeR0 - HKCU\Software\Microsoft\Internet Explorer\Main,Start Page = http://www.google.co.uk/F2 - REG:system.ini: UserInit=userinitO2 - BHO: AcroIEHlprObj Class - {06849E9F-C8D7-4D59-B87D-784B7D6BE0B3} - D:\Program Files (x86)\Adobe\Acrobat 7.0\ActiveX\AcroIEHelper.dllO4 - HKLM\..\Run: [SoundMAXPnP] C:\Program Files (x86)\Analog Devices\Core\smax4pnp.exeO4 - HKLM\..\Run: [SoundMAX] "C:\Program Files (x86)\Analog Devices\SoundMAX\Smax4.exe" /trayO4 - HKLM\..\Run: [ATICCC] "C:\Program Files (x86)\ATI Technologies\ATI.ACE\CLIStart.exe"O4 - HKLM\..\Run: [avast!] D:\PROGRA~2\ALWILS~1\Avast4\ashDisp.exeO4 - HKLM\..\Run: [avp] C:\WINDOWS\avp.exeO4 - HKLM\..\Run: [szarkrmf.exe] C:\Documents and Settings\All Users\Application Data\szarkrmf.exeO4 - HKLM\..\Run: [SManager] smanager.7.exeO4 - HKCU\..\Run: [BgMonitor_{79662E04-7C6C-4d9f-84C7-88D8A56B10AA}] "C:\Program Files (x86)\Common Files\Ahead\Lib\NMBgMonitor.exe"O4 - Global Startup: Adobe Reader Speed Launch.lnk = D:\Program Files (x86)\Adobe\Acrobat 7.0\Reader\reader_sl.exeO9 - Extra button: Messenger - {FB5F1910-F110-11d2-BB9E-00C04F795683} - C:\Program Files\Messenger\msmsgs.exeO9 - Extra 'Tools' menuitem: Windows Messenger - {FB5F1910-F110-11d2-BB9E-00C04F795683} - C:\Program Files\Messenger\msmsgs.exeO20 - Winlogon Notify: dimsntfy - C:\WINDOWS\system32\dimsntfy.dllO20 - Winlogon Notify: EFS - C:\WINDOWS\system32\sclgntfy.dllO23 - Service: avast! iAVS4 Control Service (aswUpdSv) - ALWIL Software - D:\Program Files\Alwil Software\Avast4\aswUpdSv.exeO23 - Service: Ati HotKey Poller - Unknown owner - C:\WINDOWS\system32\Ati2evxx.exe (file missing)O23 - Service: ATI Smart - Unknown owner - C:\WINDOWS\system32\ati2saag.exeO23 - Service: avast! Antivirus - ALWIL Software - D:\Program Files\Alwil Software\Avast4\ashServ.exeO23 - Service: avast! Mail Scanner - Unknown owner - D:\Program Files\Alwil Software\Avast4\ashMaiSv.exe" /service (file missing)O23 - Service: avast! Web Scanner - Unknown owner - D:\Program Files\Alwil Software\Avast4\ashWebSv.exe" /service (file missing)O23 - Service: Logical Disk Manager Administrative Service (dmadmin) - Unknown owner - C:\WINDOWS\System32\dmadmin.exe (file missing)O23 - Service: Event Log (Eventlog) - Unknown owner - C:\WINDOWS\system32\services.exe (file missing)O23 - Service: HTTP SSL (HTTPFilter) - Unknown owner - C:\WINDOWS\System32\lsass.exe (file missing)O23 - Service: IMAPI CD-Burning COM Service (ImapiService) - Unknown owner - C:\WINDOWS\system32\imapi.exe (file missing)O23 - Service: Distributed Transaction Coordinator (MSDTC) - Unknown owner - C:\WINDOWS\system32\msdtc.exe (file missing)O23 - Service: NBService - Nero AG - D:\Program Files (x86)\Nero\Nero 7\Nero BackItUp\NBService.exeO23 - Service: Net Logon (Netlogon) - Unknown owner - C:\WINDOWS\system32\lsass.exe (file missing)O23 - Service: NMIndexingService - Nero AG - C:\Program Files (x86)\Common Files\Ahead\Lib\NMIndexingService.exeO23 - Service: NT LM Security Support Provider (NtLmSsp) - Unknown owner - C:\WINDOWS\system32\lsass.exe (file missing)O23 - Service: Plug and Play (PlugPlay) - Unknown owner - C:\WINDOWS\system32\services.exe (file missing)O23 - Service: IPSEC Services (PolicyAgent) - Unknown owner - C:\WINDOWS\system32\lsass.exe (file missing)O23 - Service: Protected Storage (ProtectedStorage) - Unknown owner - C:\WINDOWS\system32\lsass.exe (file missing)O23 - Service: Remote Desktop Help Session Manager (RDSessMgr) - Unknown owner - C:\WINDOWS\system32\sessmgr.exe (file missing)O23 - Service: Security Accounts Manager (SamSs) - Unknown owner - C:\WINDOWS\system32\lsass.exe (file missing)O23 - Service: Virtual Disk Service (vds) - Unknown owner - C:\WINDOWS\System32\vds.exe (file missing)O23 - Service: Volume Shadow Copy (VSS) - Unknown owner - C:\WINDOWS\System32\vssvc.exe (file missing)O23 - Service: WMI Performance Adapter (WmiApSrv) - Unknown owner - C:\WINDOWS\system32\wbem\wmiapsrv.exe (file missing)Also saved the startup list as follows StartupList report, 01/07/2007, 16:15:15StartupList version: 1.52.2Started from : H:\Combat_Virus&Trojans\HijackThis\HijackThis.EXEDetected: Windows 2003 SP2 (WinNT 5.02.3790)Detected: Internet Explorer v6.00 SP1 (6.00.3790.1830)* Using default options==================================================Running processes:D:\Program Files\Alwil Software\Avast4\aswUpdSv.exeD:\Program Files\Alwil Software\Avast4\ashServ.exeC:\Program Files (x86)\Common Files\Ahead\Lib\NMBgMonitor.exeC:\Program Files (x86)\Analog Devices\Core\smax4pnp.exeC:\Program Files (x86)\Analog Devices\SoundMAX\Smax4.exeC:\Program Files (x86)\ATI Technologies\ATI.ACE\CLI.EXED:\PROGRA~2\ALWILS~1\Avast4\ashDisp.exeC:\WINDOWS\avp.exeC:\Documents and Settings\All Users\Application Data\szarkrmf.exeD:\Program Files\Alwil Software\Avast4\ashMaiSv.exeD:\Program Files\Alwil Software\Avast4\ashWebSv.exeC:\Program Files (x86)\Common Files\Ahead\Lib\NMIndexingService.exeC:\Program Files (x86)\Common Files\Ahead\Lib\NMIndexStoreSvr.exeC:\Program Files (x86)\ATI Technologies\ATI.ACE\cli.exeC:\Program Files (x86)\ATI Technologies\ATI.ACE\cli.exeH:\Combat_Virus&Trojans\HijackThis\HijackThis.exeC:\WINDOWS\system32\NOTEPAD.EXEC:\Program Files (x86)\Mozilla Firefox\firefox.exe--------------------------------------------------Listing of startup folders:Shell folders Common Startup:[C:\Documents and Settings\All Users\Start Menu\Programs\Startup]Adobe Reader Speed Launch.lnk = D:\Program Files (x86)\Adobe\Acrobat 7.0\Reader\reader_sl.exe--------------------------------------------------Checking Windows NT UserInit:[HKLM\Software\Microsoft\Windows NT\CurrentVersion\Winlogon]UserInit = userinit--------------------------------------------------Autorun entries from Registry:HKLM\Software\Microsoft\Windows\CurrentVersion\RunSoundMAXPnP = C:\Program Files (x86)\Analog Devices\Core\smax4pnp.exeSoundMAX = "C:\Program Files (x86)\Analog Devices\SoundMAX\Smax4.exe" /trayATICCC = "C:\Program Files (x86)\ATI Technologies\ATI.ACE\CLIStart.exe"avast! = D:\PROGRA~2\ALWILS~1\Avast4\ashDisp.exeavp = C:\WINDOWS\avp.exeszarkrmf.exe = C:\Documents and Settings\All Users\Application Data\szarkrmf.exeSManager = smanager.7.exe--------------------------------------------------Autorun entries from Registry:HKCU\Software\Microsoft\Windows\CurrentVersion\RunBgMonitor_{79662E04-7C6C-4d9f-84C7-88D8A56B10AA} = "C:\Program Files (x86)\Common Files\Ahead\Lib\NMBgMonitor.exe"--------------------------------------------------File association entry for .HTA:HKEY_CLASSES_ROOT\htafile\shell\open\command(Default) = %SystemRoot%\system32\mshta.exe "%1" %*--------------------------------------------------Shell & screensaver key from C:\WINDOWS\SYSTEM.INI:Shell=*INI section not found*SCRNSAVE.EXE=*INI section not found*drivers=*INI section not found*Shell & screensaver key from Registry:Shell=Explorer.exeSCRNSAVE.EXE=C:\WINDOWS\system32\logon.scrdrivers=*Registry value not found*Policies Shell key:HKCU\..\Policies: Shell=*Registry key not found*HKLM\..\Policies: Shell=*Registry value not found*--------------------------------------------------Enumerating Browser Helper Objects:(no name) - D:\Program Files (x86)\Adobe\Acrobat 7.0\ActiveX\AcroIEHelper.dll - {06849E9F-C8D7-4D59-B87D-784B7D6BE0B3}--------------------------------------------------Enumerating ShellServiceObjectDelayLoad items:PostBootReminder: C:\WINDOWS\syswow64\SHELL32.dllCDBurn: C:\WINDOWS\syswow64\SHELL32.dllWebCheck: C:\WINDOWS\SysWOW64\webcheck.dllSysTray: C:\WINDOWS\SysWOW64\stobject.dll

Preferred Solution: Infected With Win32:alphabet-b Trojan

I recommend downloading and running DAP. It can help sort out any driver and firmware related issues on your system

It's worked out well for many of us in the past.

You can download it direct from this link http://downloaddap.org. (This link will open the download page of DAP so you can save a copy to your computer.)

A: Infected With Win32:alphabet-b Trojan

Hello pyrotech and welcome to the BC HijackThis forum. There are a few interesting files in the log. Let's try a different scanner and see what else we can find.Download WinPFind3u.exe to your Desktop and double-click on it to extract the files. It will create a folder named WinPFind3u on your desktop.Note: You must be logged on to the system with an account that has Administrator privileges to run this program.Close ALL OTHER PROGRAMS.Open the WinPFind3u folder and double-click on WinPFind3U.exe to start the program.In the Driver Services section click on Non-Microsoft.Do not change any other settings.Now click the Run Scan button on the toolbar.Let it run unhindered until it finishes.When the scan is complete Notepad will open with the report file loaded in it.Click the Format menu and make sure that Wordwrap is not checked. If it is then click on it to uncheck it.Use the Add Reply button and Copy/Paste the information back here. I will review it when it comes in. If, after posting, the last line is not < End of Report > then the log is too big to fit into a single post and you will need to split it into multiple posts.Cheers.OT

Read other 1 answers

Please help. I Have a trojan (1st for nearly 2 years).
Here's the HJ log:

Logfile of HijackThis v1.97.7
Scan saved at 03:46:08, on 23/01/2008
Platform: Windows XP SP2 (WinNT 5.01.2600)
MSIE: Internet Explorer v6.00 SP2 (6.00.2900.2180)

Running processes:
C:\Program Files\Lavasoft\Ad-Aware 2007\aawservice.exe
C:\Program Files\Alwil Software\Avast4\aswUpdSv.exe
C:\Program Files\Alwil Software\Avast4\ashServ.exe
C:\Program Files\FlexibleSoft\Absolute Time Server\atsagent.exe
C:\Program Files\Common Files\Microsoft Shared\VS7Debug\mdm.exe
C:\Program Files\Virtual CD v4 SDK\system\vcssecs.exe
C:\Program Files\Alwil Software\Avast4\ashMaiSv.exe
C:\Program Files\Alwil Software\Avast4\ashWebSv.exe
C:\Program Files\Lexmark 2300 Series\lxcgmon.exe
C:\Program Files\BroadJump\Client Foundation\CFD.exe
C:\Program Files\Virtual CD v4 SDK\system\... Read more

A:Trojan Win32:Alphabet-P

Your version of HijackThis is terrbily outdated.

Please delete it, and then follow MicroBell's 5 Step process outlined here:


After running through all the steps, please post the requested logs.

If you have trouble with one of the steps, simply move on to the next one, and make note of it in your reply.

Read other 2 answers

Hi Board Members

I'm having real trouble clearing a trojan from my PC. I have the usual tools but none have cleared it.

Here's my HiJackThis. Any assistance would be appreciated. Thanks in advance.

Logfile of HijackThis v1.99.1
Scan saved at 17:18:08, on 19/05/2007
Platform: Windows XP SP1 (WinNT 5.01.2600)
MSIE: Internet Explorer v6.00 SP1 (6.00.2800.1106)

Running processes:
C:\Program Files\QuickTime\qttask.exe
C:\Program Files\Zone Labs\ZoneAlarm\zlclient.exe
C:\Program Files\Grisoft\AVG Anti-Spyware 7.5\avgas.exe
C:\Program Files\Panicware\Pop-Up Stopper Free Edition\PSFree.exe
C:\Program Files\Microsoft Office\Office\OSA.EXE
C:\Program Files\NETGEAR\WG111T Configuration Utility\wlan111t.exe
C:\Program Files\HijackThis\HijackThis.exe

O2 - BHO: AcroIEHlprObj Class - {06849E9F-C8D7-4D59-B87D-784B7D6BE0B3} - C:\Program Files\Adobe\Acrobat 5.0\Reader\ActiveX\AcroIEHelper.ocx
O2 - BHO: (no name) - {2536D71E-CBC6-40C2-9F41-9F363CF08FA3} - c:\windows\system32\ekbaekb.dll
O2 - BHO: (no name) - {53707962-6F74-2D53-2644-206D7942484F} - C:\Program Files\Spybot - Search & Destroy\SDHelper.dll
O2 - BHO: Image Helper - {ABDAC2AD-A4DE-A8FC-AE72-3A3A94635866} - C:\WINDOWS\system\bomtcs32.dll (file missing)
O3 - Toolbar: &Radio - {8E718888-423F-11D2-876E-00A0C9082467} - C:\WINDOWS\System32\msdxm.ocx
O4 - HKLM\..\Run: [QuickTime Task] "C:\Program Fil... Read more

A:Solved: Win32 Alphabet Trojan

Read other 11 answers

I ran my anti-virus software and found that I have Trojan-Downloader.Win32.Alphabet.er

followed by

Documents and Settings\LocalService\Local Settings\Application Data\PCHealth\ErrorRep\QSignoff\268495.cab\{90312EE2_6524_890F_B3CF_1310A4D43B7E}_857060.dll 0

but my anti-virus software won't get rid of it! By the way, visited microsoft's website and ran their malicious software program and after running over 6 hours - it says I have no problems!!!! AGGHHHH!!! HELP!!


The process of cleaning your computer may require temporarily disabliling some security programs. If you are using SpyBot Search and Destroy, please refer to Note 2 at the bottom of this page.Please download Malwarebytes Anti-Malware and save it to your desktop.alternate download link 1alternate download link 2Make sure you are connected to the Internet.Double-click on mbam-setup.exe to install the application.When the installation begins, follow the prompts and do not make any changes to default settings.When installation has finished, make sure you leave both of these checked:Update Malwarebytes' Anti-MalwareLaunch Malwarebytes' Anti-MalwareThen click Finish.MBAM will automatically start and you will be asked to update the program before performing a scan.If an update is found, the program will automatically update itself.Press the OK button to close that box and continue.If you encounter any problems while downloading the updates, manually download them from here and just double-click on mbam-rules.exe to install.On the Scanner tab:Make sure the "Perform Quick Scan" option is selected.Then click on the Scan button.If asked to select the drives to scan, leave all the drives selected and click on the Start Scan button. The scan will begin and "Scan in progress" will show at the top. It may take some time to complete so please be patient.When the scan is finished, a message box will say "The scan completed successfully. Click 'Show Results' to display all objects found".Clic... Read more

Read other 3 answers

I keep getting a warning from my anti-virus every 2 minutes that a Trojan Horse was found. No matter how many times I delete the file, it keeps coming back.

Here is a copy of my HJT log (Im using Windows XP Sp2):


Logfile of Trend Micro HijackThis v2.0.2
Scan saved at 7:04:49 PM, on 24/01/2008
Platform: Windows XP SP2 (WinNT 5.01.2600)
MSIE: Internet Explorer v7.00 (7.00.6000.16574)
Boot mode: Normal

Running processes:
C:\Program Files\Alwil Software\Avast4\aswUpdSv.exe
C:\Program Files\Alwil Software\Avast4\ashServ.exe
C:\Program Files\Common Files\InstallShield\UpdateService\issch.exe
C:\Program Files\Java\jre1.6.0_03\bin\jusched.exe
C:\Program Files\Adobe\Photoshop Album Starter Edition\3.0\Apps\apdproxy.exe
C:\Program Files\iTunes\iTunesHelper.exe
C:\Program Files\Analog Devices\Core\smax4pnp.exe
C:\Program Files\Analog Devices\SoundMAX\Smax4.exe
C:\Program Files\Canon\MyPrinter\BJMyPrt.exe
C:\Program Files\ScanSoft\OmniPageSE4\OpwareSE4.exe
C:\Program Files\Adobe\Acrobat 8.0\Acrobat\Acrotray.exe
C:\Program Files\Google\GoogleToolbarNotif... Read more

A:Trojan Horse Malware - Win32-Alphabet-P

I think I did it

win24.exe was the problem. When you google it, you can tell its definitely Malware. Since I removed it 10 minutes ago, not a single warning or virus detection has occurred.

Read other 2 answers


I has run an ad-aware scan and was manually examining files in the temp folder. Avast v4.7 home edition picked up a trojan
file name: http://void.theoreon.com/exe.php?ex=1039\[PECompact]\[E
malware name: Win32:Alphabet-L [Trj]
VPS version: 071226-0, 12/26/2007

I followed the steps required before posting a thread and was unsuccessful running the panda scandue to a virus.
file name: http://acs.pandasoftware.com/actives...cab\pskavs.DLL
malware name: Win32:CTX

So what do I need to do to clean these files? Attached is the extra.txt and please review DSS below.

Thank you
Deckard's System Scanner v20071014.68
Run by Janet Ploetz on 2007-12-27 08:50:22
Computer is in Normal Mode.

-- System Restore --------------------------------------------------------------

Successfully created a Deckard's System Scanner Restore Point.

-- Last 5 Restore Point(s) --
94: 2007-12-27 13:50:37 UTC - RP1205 - Deckard's System Scanner Restore Point
93: 2007-12-26 22:40:46 UTC - RP1204 - System Checkpoint
92: 2007-12-25 22:38:30 UTC - RP1203 - System Checkpoint
91: 2007-12-24 21:40:27 UTC - RP1202 - System Checkpoint
90: 2007-12-23 21:35:12 UTC - RP1201 - System Checkpoint

-- First Restore Point --
1: 2007-09-28 23:35:21 UTC - RP1112 - System Checkpoint

Backed up registry hives.
Performed disk cleanup.

-- HijackThis Clone ---------------------------------... Read more

A:Win32:Alphabet-L trojan detected by avast

Please copy this page to *Notepad* and save to your desktop for reference as you will not have any browsers open while you are carrying out portions of these instructions.

It's IMPORTANT to carry out the instructions in the sequence listed below.
1. Close any open browsers.
2. Close/disable all anti virus and anti malware programs so they do not interfere with the running of ComboFix.

Open *notepad* and copy/paste the text in the quotebox below into it:




Save this as CFScript.txt, in the same location as ComboFix.exe which is on the Desktop.

Refering to the picture above, drag CFScript.txt into ComboFix.exe

Restart your computer.

When finished, it shall produce a log for you at C:\ComboFix.txt

Please copy and paste the ComboFix.txt along with a fresh HijackThis log in your next reply please.

Do not mouseclick combofix's window whilst it's running. That may cause it to stall*


Go to http://www.kaspersky.com/kos/eng/par...avwebsc... Read more

Read other 1 answers

Hi, here is my problem. Everytime I download some movies or other things by opening my computer overnight, it must pop out a error window said:-C:\Documents and setting\KkianN\Desktop is not accessible.Not enough quota is available to process this command.The icons only left on my screen were My computer,my network places and Internet explorer. When I refresh my computer, it came out the same message again.(this problem was occured when I opened my computer overnight by using Thunder5 this software to download things)When I tried to shut down, a message said You do not have permission to shut down this computer.When I tried to use windows task manager to shut down,once i click Ctrl+Alt+Del, an application error message came out said:-This application failed to initialize properly(0xc000012d). Click on OK to terminate the application.Then I just can reset my computer.Actually I have posted in BleepingComputer.com > Security > Am I infected? What do I do? there.Then I followed the instruction in "Preparation Guide For Use Before Posting A Hijackthis Log". Unfortunately,i can't finish all the steps there. For step 4, I can't remove win32.generic.pws,win32.trojan.psw.delf and Win32.trojan.pws.onlinegames by using Ad-aware 2007. While scanning by using spybot,it stuck while scanning.After that suddenly pop out a window said:-Spybot-Search and destroy has detected an important registry entry that has been changed. Category: System Startup global entr... Read more

A:Infected With Dropper.agent,logger.pcap.a,win32.generic.pws,win32.trojan.psw.delf And Win32.trojan.pws.onlinegames

Hello, I had reformatted my computer since it could not open and stuck in the welcome window few days ago. So, now my computer is alright..thanks for viewing and trying to help me to fix the problem.

Read other 1 answers

Hi,Please help me in getting rid of the pop ups which keep coming up.trojan downloader win32 agent bqtrojan clicker win32 tiny htrojan spy win32 key logger.aatrojan spy win32 green screentrojan spy html bankfraud.dqHijakThis log file.Logfile of Trend Micro HijackThis v2.0.2Scan saved at 15:00:40, on 9/8/2008Platform: Windows XP SP2 (WinNT 5.01.2600)MSIE: Internet Explorer v7.00 (7.00.6000.16705)Boot mode: NormalRunning processes:C:\WINDOWS\System32\smss.exeC:\WINDOWS\system32\csrss.exeC:\WINDOWS\system32\winlogon.exeC:\WINDOWS\system32\services.exeC:\WINDOWS\system32\lsass.exeC:\WINDOWS\system32\svchost.exeC:\WINDOWS\system32\svchost.exeC:\WINDOWS\System32\svchost.exeC:\WINDOWS\system32\svchost.exeC:\WINDOWS\system32\svchost.exeC:\Program Files\Common Files\Symantec Shared\ccProxy.exeC:\Program Files\Common Files\Symantec Shared\ccSetMgr.exeC:\Program Files\Symantec Client Security\Symantec Client Firewall\ISSVC.exeC:\Program Files\Common Files\Symantec Shared\SNDSrvc.exeC:\Program Files\Common Files\Symantec Shared\SPBBC\SPBBCSvc.exeC:\Program Files\Common Files\Symantec Shared\ccEvtMgr.exeC:\WINDOWS\system32\spoolsv.exeC:\WINDOWS\Explorer.EXEC:\Program Files\Hewlett-Pac... Read more

A:Infected With Trojan Clicker Win32 Tiny.h / Downloader Win32 Agent Bq / Spy Win32 Key Logger.aa/spy Win32 Green Screen / Html B...

Sorry for the delay. If you are still having problems please post a brand new HijackThis log as a reply to this topic. Before posting the log, please make sure you follow all the steps found in this topic:Preparation Guide For Use Before Posting A Hijackthis LogPlease also post the problems you are having.

Read other 1 answers

Hello,My computer became infected last night, and It's pretty bad. I became infected with Infected: Trojan:Win32/Alureon.BT, Win32:Jifas-CY, and the others listed (maybe more). Long story short, I'd just watched Harry Potter on dvd, and logged onto the computer to see who he married in the end. I ended up at a Harry Potter encyclipdiea website, and looked it up. Avast went nuts after a few minutes, and showed 4 different virus alerts, and Windows Defender showed 1 as well after I shut down.The virus listed by Defender was Trojan:Win32/Alureon.BT. Avast listed Win32:Jifas-CY, I didn't get the others in time.The last 2 I listed in the title, a "security center alert" claimed it detected these programs trying to acess the internet. It listed one more, but I didn't get it's name in time.I know Alureon is a downloader and backdoor for other viruses, and it basically shuts down security systems, which it's trying to do since windows now thinks I have no anti-virus installed.All of these trojans are listed as "server" and "high risk." I'm not sure a root kit didn't try to make it's way in too.EDIT: I wanted to add a few things in. First, I have XP SP3 set up with multiple accouts, one admin "owner" account and then 1 limited access "user" account. The Viruses came in while the user account was logged on (I am not dumb enough to connect to the internet with an admin account). It seems the Viruses we... Read more

A:Infected: Trojan:Win32/Alureon.BT, Win32:Jifas-CY, Backdoor.Win32.Kbot.al, Net-Worm.Win32.Mytob.t

Hello again.I booted into Safe Mode and ran an Avast scan (which took forever) and it was a waste of time. The stupid thing found nothing wrong, and said the system was clean (which is the opposite it says when you log into the limited user account). The computer (and specially that account at least) is definitely infected. Could the viruses be hiding themselves when in safe mode?Should I scan from a Pre-install environment like BartPE? Or from the Regular "Owner" Admin account? I waited 2 days for the stupid program to scan 700gb (painfully slow for a qaud core, though to be excepted in safe mode), and it was useless.Other than running windows defender (which I'm doing now), and maybe trying MBAM, I'm not sure what to do. I'm not expect enough to dive into programs like OTViewIT and Combofix, so I'll need help here. Please, ANY HELP is appreciated. I would rather NOT wipe the drive and reinstall the whole system, but I need to get this figured out.Does no one have any ideas???

Read other 5 answers

KASPERSKY ONLINE SCANNER 7 REPORTSaturday, November 29, 2008Operating System: Microsoft Windows XP Professional Service Pack 3 (build 2600)Kaspersky Online Scanner 7 version: database last update: Friday, November 28, 2008 18:35:48Records in database: 1424124Scan settingsScan using the following database extendedScan archives yesScan mail databases yesScan area My ComputerC:\D:\E:\F:\Scan statisticsFiles scanned 94300Threat name 4Infected objects 4Suspicious objects 0Duration of the scan 02:45:29File name Threat name Threats countC:\Documents and Settings\All Users\Application Data\FreeApp.exe Infected: Trojan.Win32.Agent.arng 1 C:\Qoobox\Quarantine\C\Program Files\tinyproxy\tinyproxy.exe.vir Infected: Trojan-Proxy.Win32.Agent.bcw 1 C:\RECYCLER\S-1-5-21-1482476501-1644491937-682003330-1013\winse32.exe Infected: IRC-Worm.Win32.Small.x 1 C:\WINDOWS\bolivar24.exe Infected: Backdoor.Win32.Agent.ubx 1 The selected area was scanned.----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Logfile of random's system information tool 1.04 (written by random/random... Read more

A:Infected: Trojan.Win32.Agent.arng, Trojan-Proxy.Win32.Agent.bcw, IRC-Worm.Win32.Small.x, Backdoor.Win32.Agent.ubx

Hello and to Bleeping ComputerWe apologize for the delay in responding to your request for help. Here at Bleeping Computer we get overwhelmed at times, and we are trying our best to keep up. Please note that your topic was not intentionally overlooked. Our mission is to help everyone in need, but sometimes it takes just a little longer to get to every request for help.If you have since resolved the original problem you were having, we would appreciate you letting us know. If not please perform the following steps below so we can have a look at the current condition of your machine. If you have not done so, include a description of your problem, along with any steps you may have performed so far.Upon completing the steps below a staff member will review and take the steps necessary with you to get your machine back in working order clean and free of malware.Thanks and again sorry for the delay.We need to see some information about what is happening in your machine. Please perform the following scan:Download DDS by sUBs from one of the following links. Save it to your desktop.DDS.comDDS.scrDDS.pifDouble click on the DDS icon, allow it to run.A small box will open, with an explaination about the tool. No input is needed, the scan is running.Notepad will open with the results, click no to the Optional_ScanFollow the instructions that pop up for posting the results.Close the program window, and delete the program from your desktop.Please note: You may have to disable any scr... Read more

Read other 4 answers

I ran my anti-virus software and found that I have Trojan-Downloader.Win32.Alphabet.er followed by Documents and Settings\LocalService\Local Settings\Application Data\PCHealth\ErrorRep\QSignoff\268495.cab\{90312EE2_6524_890F_B3CF_1310A4D43B7E}_857060.dll 0 but my anti-virus software won't get rid of it! By the way, visited microsoft's website and ran their malicious software program and after running over 6 hours - it says I have no problems!!!! AGGHHHH!!! HELP!! I have had a variant for over 2 months on my desktop; it's taken me this long to find sites that even linked the suspect filenames I'd found (afinding, nobicyt, wserving, et al) to an actual virus name. Most threads died off as people gave up and reformatted their hard drives.What most posters are not reporting (and therefore getting usable advice) 1. is loss of connection to the Internet on the infected machine. I know it's bogus, since the network and wireless printers are working, but on this desktop there is no internet access, no printers, and no way to turn anything on. I can't get a browser window to access anything, meaning I cannot download software to install. 2. Tried installing antivirus programs on the CD; machine won't recognize the cd drive.3. Tried transferring programs on jumpdrive; mouse will not drag/drop, can copy but not paste, cannot send to desktop.4. The few that would run off the jump... Read more

Read other answers

ok my avast on-access protection has been whining about a win32:alphabet.gen trojan in my temp files and every time it detects it the temp file changes i need help getting rid of this by the way im running windows vista on 2gb ddr2 ram dual 512mb nvidia geforce 8800 sli video cards and i cannot afford to reformat or wipe my hard drive please help


Read other 8 answers

I have an F-Secure internet security software suite on this computer, and it is up-to-date and functioning. I also have MalwareBytes (free) installed and have been running it regularly, and I use the ESET Online Scanner as well. The OS is Windows XP, and it is up-to-date.About three weeks ago I cleaned around three trojans from this computer using MBAM and the online scanner. A few days ago, Adware.Win32.WebHancer.x was found by F-Secure, and is currently quarantined. Today, several instances of the two Trojan-Spy programs were found and quarantined by F-Secure; they infect system files and system restore files. I already looked up information on cleaning the system restore files by stopping and restarting system restore (and scanning inbetween). I deleted the quarantined files.All of the Spy-Trojan's found are infecting in C:\hp\recovery\wizard\fscommand\. The file names are:AppRecoveryLink_ret.exeCDLogic_ret.exeCreatorLink_ret.exeRestoreLink_ret.exeRTCDLink_ret.exeRunLink_ret.exeSysRecoveryLink_ret.exeWizardLink_ret.exeThe Adware infected a .dll file, and I was advised not to delete it.CDLogic_ret.exe is Agent.bdzz; the rest are Agent.beafI have run my antivirus, MBAM, and the online scanner again and they picked up nothing. Also, the Adware and Trojan-Spy's were all found during MBAM scans, but F-Secure picked them up.I have attached a HiJackThis log and a DDS log; GMER froze my computer partway through the scan when I used it. I have ran a... Read more

A:Infected with Trojan-Spy.Win32.Agent.bdzz, Trojan-Spy.Win32.Agent.beaf, and Adware.Win32.WebHancer.x

Hello and welcome to Bleeping ComputerWe apologize for the delay in responding to your request for help. Here at Bleeping Computer we get overwhelmed at times, and we are trying our best to keep up. Please note that your topic was not intentionally overlooked. Our mission is to help everyone in need, but sometimes it takes just a little longer to get to every request for help. No one is ignored here.If you have since resolved the original problem you were having, we would appreciate you letting us know. If not please perform the following steps below so we can have a look at the current condition of your machine. If you have not done so, include a clear description of the problems you're having, along with any steps you may have performed so far.Upon completing the steps below another staff member will review and take the steps necessary with you to get your machine back in working order clean and free of malware.If you have already posted a DDS log, please do so again, as your situation may have changed.Use the 'Add Reply' and add the new log to this thread.Thanks and again sorry for the delay.We need to see some information about what is happening in your machine. Please perform the following scan:Download DDS by sUBs from one of the following links. Save it to your desktop.DDS.scrDDS.pifDouble click on the DDS icon, allow it to run.A small box will open, with an explaination about the tool. No input is needed, the scan is running.Notepad will open with the results.Foll... Read more

Read other 2 answers

It attacked IE first. I used Ad-Aware and CCleaner. It seemed to go away. Then it came back and attacked Firefox. I used Malwarebytes' Anti-Malware in conjunction with Ccleaner and it wouldn't go away. After every use, there would still be another DLL file to find and destroy, even if Malwarebytes' Anti-Malware said it was successful. Often the files that returned were different DLLs then before.I have no Window's Explorer due to this infection. Managed to run tasks anyway and found you guys on google when I entered in a DLL file name that I had originally found while scanning. I can't recall the name of the offending DLL... Ran the Kaspersky Scanner, and the Highjack This Scanner. All results are posted below. KASPERSKY ONLINE SCANNER 7 REPORTSaturday, December 6, 2008Operating System: Microsoft Windows XP Professional Service Pack 2 (build 2600)Kaspersky Online Scanner 7 version: database last update: Saturday, December 06, 2008 03:47:06Records in database: 1439820Scan settingsScan using the following database extendedScan archives yesScan mail databases yesScan area Critical AreasC:\Documents and Settings\All Users\Start Menu\Programs\StartupC:\Documents and Settings\Kienzle\Start Menu\Programs\StartupC:\Program FilesC:\WINDOWSScan statisticsFiles scanned 112172Threat name 2Infected objects 2Suspicious objects 0Duration of the scan 01:05:54File name Threat name Threats countC:\WINDO... Read more

A:Infected; Trojan.Win32.Agent.asjk, Trojan.Win32.Monder.aane

Hello! My name is Sam and I will be helping you. In order to see what's going on with your computer I may ask for you to post various logs from the tools that we will use to resolve your issue. Please also share with me any information about how your computer is reacting and behaving each step of the way as we work through this process.Please download ComboFix from one of these locations:Link 1Link 2Link 3Important!You should NOT use Combofix unless you have been instructed to do so by a Malware Removal Expert. It is intended by its creator to be used under the guidance and supervision of an Malware Removal Expert, not for private use.Using this tool incorrectly could lead to disastrous problems with your operating system such as preventing it from ever starting again. Make sure that you save ComboFix.exe to your DesktopDisable your AntiVirus and AntiSpyware applications, usually via a right click on the System Tray icon. They may otherwise interfere with our tools

Double click on ComboFix.exe & follow the prompts.

As part of it's process, ComboFix will check to see if the Microsoft Windows Recovery Console is installed. With malware infections being as they are today, it's strongly recommended to have this pre-installed on your machine before doing any malware removal. It will allow you to boot up into a special recovery/repair mode that will allow us to more easily help you should your computer have a problem after an attempted removal of malware.

Follow... Read more

Read other 19 answers

Help!!! I've been battling this bugger all day!!! I found a thread here (http://forums.techguy.org/security/571436-smanager-7-exe.html) which is similar to my problem and have followed all advice through running CC Cleaner and AVG in safe mode. I am back in normal mode and Avast is still warning me about every two minutes that it has found this trojan in what appears to be random, ever-changing temporary .exe files. I also am getting constant pop-ups from virus protection software. I'm about to scream! I have also run VundoFix and SmitFraudFix today -- also without success. We have 4 users on this pc -- do I need to run these things on everyone's screen names?

I just downloaded HIJack this (and had a little trouble installing it -- it kept disappearing, so I had to install REALLY FAST)

Here is my log:
D:\Program Files\Avast4\aswUpdSv.exe
D:\Program Files\Avast4\ashServ.exe
D:\Program Files\Grisoft\AVG Anti-Spyware 7.5\guard.exe
C:\Program Files\Sony\VAIO Media Music Server\SSSvr.exe
C:\Program Files\Sony\Photo Server 20\appsrv\PicAppSrv.exe
C:\Program Files\Common Files\Sony Shared\VAIO Media Platform\SV_Httpd.exe
C:\Program Files\Common Files\Sony Shared\VAIO Media Platform... Read more

A:Win32:Alphabet infection

Read other 9 answers

So I keep getting Win32.TrojanDownloader.Alphabet and MSGR.exe on every scan of lavasoft adaware and I delete them and they keep coming back. Also I have noticed my internet has gotten considerably slower. Logfile of Trend Micro HijackThis v2.0.2Scan saved at 11:16:07 PM, on 9/20/2007Platform: Windows XP SP2 (WinNT 5.01.2600)MSIE: Internet Explorer v7.00 (7.00.5730.0011)Boot mode: NormalRunning processes:C:\WINDOWS\System32\smss.exeC:\WINDOWS\system32\winlogon.exeC:\WINDOWS\system32\services.exeC:\WINDOWS\system32\lsass.exeC:\WINDOWS\system32\svchost.exeC:\WINDOWS\System32\svchost.exeC:\WINDOWS\system32\ZoneLabs\vsmon.exeC:\Program Files\Lavasoft\Ad-Aware 2007\aawservice.exeC:\WINDOWS\system32\spoolsv.exeC:\Program Files\Comodo\common\CAVASpy\cavasm.exeC:\WINDOWS\system32\HPZipm12.exeC:\WINDOWS\system32\slserv.exeC:\WINDOWS\system32\svchost.exeC:\WINDOWS\System32\svchost.exeC:\WINDOWS\system32\wscntfy.exeC:\WINDOWS\Explorer.EXEC:\Program Files\Zone Labs\ZoneAlarm\zlclient.exeC:\Program Files\Comodo\Comodo AntiVirus\CMain.exeC:\WINDOWS\TEMP\win214.tmp.exeC:\WINDOWS\mgrs.exeC:\Program Files\Comodo\Comodo AntiVirus\Cavaud.exeC:\Program Fi... Read more

A:Win32.trojandownloader.alphabet And Msgr.exe

Sorry for the delayed reply,we have been very busyGo here to run an online scannner from Kaspersky.Note: You will need to use Internet explorer for this scan Click on "Kaspersky Online Scanner" A new smaller window will pop up. Press on "Accept". After reading the contents. Now Kaspersky will update the anti-virus database. Let it run. Click on "Next">"Scan Settings", and make sure the database is set to "extended". And check both the scan options. Then click OK. Then click on "My Computer", and the scan will start. Once finished, save the log as "KAV.txt" to the desktop.Note for Internet Explorer 7 users: If at any time you have trouble with the accept button of the licence, click on the Zoom tool located at the right bottom of the IE window and set the zoom to 75 %. Once the license accepted, reset to 100%.Post back with the Kaspersky log and a new HijackThis log

Read other 1 answers

hi im new to this forum and im having some trouble with a win32 alphabet trojan below is the problem description and HJT log all help will be appreciated

ok my avast on-access protection has been reporting about a win32:alphabet.gen trojan in my temp files and every time it detects it the temp file changes i need help getting rid of this by the way im running windows vista on 2gb ddr2 ram dual 512mb nvidia geforce 8800 sli video cards and i cannot afford to reformat or wipe my hard drive please help by the way im running vista and i get avast pop ups about every minute i have very important files on this computer and since i bought it pretty new i had to gegt a reformat disk made for vista but i never took it in to get made so i cant reformat and i dont know my serial number so i cannot reformat he;lp please i really need to get this trojan off my computer...thanks
I went ahead and did a hijackthis report but an error or something poped up that i ignored and here are the results
Logfile of HijackThis v1.99.1
Scan saved at 9:10:37 PM, on 5/17/2007
Platform: Unknown Windows (WinNT 6.00.1904)
MSIE: Internet Explorer v7.00 (7.00.6000.16386)

Running processes:
C:\Program Files\Windows Defender\MSASCui.exe
C:\Program Files\Synaptics\SynTP\SynTPEnh.exe
C:\Program Files\Java\jre1.6.0_01\bin\jusched.exe
C:\Acer\Empowering Technology\eDataSecurity\eDSloader.exe
C:\Windows\S... Read more

A:Solved: Win32 alphabet INFECTION PLEASE HELP!!!

i think i fixed it i installed SUPERanti-spyware and it detected 30 trojans and deleted them all im not sure its fixed but so far no avast pop ups have popped up hopely this mess is over

Read other 2 answers

My computer has been infected with Win32/Rootkit.Agent.ODG trojan and Win32/Olmarik.JU trojan. AVG, ESET NOD32, and Avira couldn't delete it, and I want to delete it. It redirected all Google searches and slows down my computer. Can you please help me. Thanks ahead to anyone who can help.Here is the HJT logfile:Logfile of Trend Micro HijackThis v2.0.2Scan saved at 2:28:51 PM, on 18/08/2009Platform: Windows XP SP3 (WinNT 5.01.2600)MSIE: Internet Explorer v8.00 (8.00.6001.18702)Boot mode: NormalRunning processes:C:\WINDOWS\System32\smss.exeC:\WINDOWS\system32\winlogon.exeC:\WINDOWS\system32\services.exeC:\WINDOWS\system32\lsass.exeC:\WINDOWS\system32\Ati2evxx.exeC:\WINDOWS\system32\svchost.exeC:\Program Files\Windows Defender\MsMpEng.exeC:\WINDOWS\System32\svchost.exeC:\WINDOWS\system32\svchost.exeC:\WINDOWS\system32\ZoneLabs\vsmon.exeC:\Program Files\CheckPoint\ZAForceField\IswSvc.exeC:\WINDOWS\system32\LEXBCES.EXEC:\WINDOWS\system32\spoolsv.exeC:\WINDOWS\system32\LEXPPS.EXEC:\WINDOWS\Explorer.EXEC:\Program Files\Avira\AntiVir Desktop\sched.exeC:\Program Files\Avira\AntiVir Desktop\avguard.exeC:\Program Files\Common Files\Apple\Mobile Device Support\bin\AppleMobileDeviceService.exeC... Read more

A:Infected with Win32/Rootkit.Agent.ODG trojan and Win32/Olmarik.JU trojan

Hello and to Bleeping ComputerWe apologize for the delay in responding to your request for help. Here at Bleeping Computer we get overwhelmed at times, and we are trying our best to keep up. Please note that your topic was not intentionally overlooked. Our mission is to help everyone in need, but sometimes it takes just a little longer to get to every request for help. No one is ignored here.If you have since resolved the original problem you were having, we would appreciate you letting us know. If not please perform the following steps below so we can have a look at the current condition of your machine. If you have not done so, include a clear description of the problems you're having, along with any steps you may have performed so far.Upon completing the steps below another staff member will review and take the steps necessary with you to get your machine back in working order clean and free of malware.If you have already posted a DDS log, please do so again, as your situation may have changed.Use the 'Add Reply' and add the new log to this thread.Thanks and again sorry for the delay.-----------------------------------------------------------We need to see some information about what is happening in your machine. Please perform the following scan:Download DDS by sUBs from one of the following links. Save it to your desktop.DDS.scrDDS.pifDouble click on the DDS icon, allow it to run.A small box will open, with an explaination about the tool. No input is needed, ... Read more

Read other 20 answers

The last two days my computer has frozen up while trying to surf around online. This seemed weird so I ran a full system scan with symantec endpoint both days. Both times the logs came back with no risks detected. Today I started getting internet explorer pops directing me to sites. I knew at this point I had an infection that endpoint was not picking up. I disabled my network card and used another computer to download some of the suggest programs I've seen on this site. I has hoping to at least get the problem quarantined so that I would feel safe enough to enable the network card again. After running the utilities, I am not freezing when surfing web pages and have resumed using the computer. I would like help making sure that my computer is clean since endpoint obviously isn't catching this problem. Below are the logs for Kaspersky Online Scan & DSS.Deckard's System Scanner v20071014.68Run by bgedeon on 2008-07-29 14:40:22Computer is in Normal Mode.---------------------------------------------------------------------------------- HijackThis (run as bgedeon.exe) ---------------------------------------------Logfile of Trend Micro HijackThis v2.0.2Scan saved at 14:40, on 2008-07-29Platform: Windows XP SP3 (WinNT 5.01.2600)MSIE: Internet Explorer v6.00 SP3 (6.00.2900.5512)Boot mode: NormalRunning processes:C:\WINDOWS\System32\smss.exeC:\WINDOWS\system32\winlogon.exeC:\WINDOWS\system32\services.exeC:\WINDOWS\s... Read more

A:Infected With Trojan.win32.monder.bcb & Trojan-downloader.win32.agent.xxa

I continued to investigate on my own. Combofix quaratined some files, but did not delete them. A scheduled full system scan with endpoint finally picked up some infections with the newest updates loaded. Symantec scan labels the infections as Trojan.Vundo and Trojan.Metajuan. Metajuan was removed automatically, but Vundo proved to be a little more pesky. Symantec offers a removal tool for Vundo on there website. I opted to try out Malwarebytes' Anti-Malware (mbam). It was able to located the files that were in quaratine and some infected files that were in system restore. I disable system restore to avoid any problems and mbam was able to delete all the files. After a system restart, I scanned with Symantec Vundo tool and found no further signs of infection. Mbam did a good job Re-enabled system restore and recreated a fresh restore point. I'm hoping that this will be in the end of this problem, but would still be interested in someone combing through some of my logs to see if anything was missed. I'm still a little miffed that endpoint had not picked these infections up when they are not exactly new threats and I had the most current definitions when I ran my previous scans.

Read other 10 answers

i am sorry to post a log over here, as i have read through the forum and try to resolve the problem on my own but i failed.since i had ran the comboFix, so i feel that it may be of help to post it.sorry for the trouble..here's the log file...ComboFix 09-07-28.06 - Bentley 07/30/2009 0:35.1.8 - NTFSx86Microsoft? Windows Vista? Ultimate 6.0.6001.1.1252.1.1033.18.3069.1872 [GMT 8:00]Running from: c:\users\Bentley\Desktop\ComboFix.exeSP: SUPERAntiSpyware *disabled* (Updated) {222A897C-5018-402e-943F-7E7AC8560DA7}SP: Windows Defender *enabled* (Updated) {D68DDC3A-831F-4FAE-9E44-DA132C1ACF46} * Created a new restore point.((((((((((((((((((((((((((((((((((((((( Other Deletions ))))))))))))))))))))))))))))))))))))))))))))))))).c:\windows\Install.txtc:\windows\system32\tmp0_144047822718.bkc:\windows\system32\tmp0_16962678345.bkc:\windows\system32\tmp0_205418834021.bkc:\windows\system32\tmp0_355351885288.bkc:\windows\system32\tmp0_424346226483.bkc:\windows\system32\tmp0_516880812123.bkc:\windows\system32\tmp0_517948877969.bkc:\windows\system32\tmp0_525286544717.bkc:\windows\system32\tmp0_687442396617.bkc:\windows\system32\tmp0_77071886817.bkc:\windows\system32\tmp0_779592338841.bkc:\windows\system32\tmp0_790261416358.bkc:\windows\system32\tmp2_1075327197... Read more

A:Infected with win32/rootkit.agent.ODG trojan and win32/Olmarik.JU trojan

Hello and welcome to Bleeping ComputerWe apologize for the delay in responding to your request for help. Here at Bleeping Computer we get overwhelmed at times, and we are trying our best to keep up. Please note that your topic was not intentionally overlooked. Our mission is to help everyone in need, but sometimes it takes just a little longer to get to every request for help. No one is ignored here.If you have since resolved the original problem you were having, we would appreciate you letting us know. If not please perform the following steps below so we can have a look at the current condition of your machine. If you have not done so, include a clear description of the problems you're having, along with any steps you may have performed so far.Upon completing the steps below another staff member will review and take the steps necessary with you to get your machine back in working order clean and free of malware.If you have already posted a DDS log, please do so again, as your situation may have changed.Use the 'Add Reply' and add the new log to this thread.Thanks and again sorry for the delay.We need to see some information about what is happening in your machine. Please perform the following scan:Download DDS by sUBs from one of the following links. Save it to your desktop.DDS.scrDDS.pifDouble click on the DDS icon, allow it to run.A small box will open, with an explaination about the tool. No input is needed, the scan is running.Notepad will open with the results.Foll... Read more

Read other 2 answers

Hello and welcome to Bleeping ComputerWe apologize for the delay in responding to your request for help. Here at Bleeping Computer we get overwhelmed at times, and we are trying our best to keep up. Please note that your topic was not intentionally overlooked. Our mission is to help everyone in need, but sometimes it takes just a little longer to get to every request for help.If you have since resolved the original problem you were having, we would appreciate you letting us know. If not please perform the following steps below so we can have a look at the current condition of your machine. If you have not done so, include a description of your problem, along with any steps you may have performed so far.Upon completing the steps below a staff member will review and take the steps necessary with you to get your machine back in working order clean and free of malware.Thanks and again sorry for the delay.We need to see some information about what is happening in your machine. Please perform the following scan:Download DDS by sUBs from one of the following links. Save it to your desktop.DDS.comDDS.scrDDS.pifDouble click on the DDS icon, allow it to run.A small box will open, with an explanation about the tool. No input is needed, the scan is running.Notepad will open with the results, click no to the Optional_ScanFollow the instructions that pop up for posting the results.Close the program window, and delete the program from your desktop.Please note: You may have to disable a... Read more

A:Infected: Trojan.Win32.Inject.kom and Trojan.Win32.Monder.aamw

Thanks for the reply, but I went ahead and upgraded that machine with a new hard drive.

Read other 3 answers

Heres whats happening, I have entered a site which apparently directed me to a site with huge amounts of popups. Moments later I managed to exit all those adult popups, and I discovered that my browser (IE) is running a bit slower than usual AND there are popups in Google Search. I ran a scan with Ad-Aware SE Personal and win32.trojandownloader.alphabet shows up. I quarantined it. But it shows up again after each login. Now as I'm typing, the computer skips out on some letters I type as if it clicks somewhere else and then back while I type so sometimes I type "a" but I meant to type "as" into the text box. Also sometimes random "sex noises" comes on the speakers for no apparent reason. Popups come out when I leave the computer idle for 5 minutes after login. Heres a hijackthis log I just made:

Logfile of HijackThis v1.99.1
Scan saved at 10:46:49 PM, on 5/31/2007
Platform: Windows XP SP2 (WinNT 5.01.2600)
MSIE: Internet Explorer v6.00 SP2 (6.00.2900.2180)

Running processes:
C:\Program Files\MSN Messenger\usnsvc.exe
C:\WINDOWS\system32\Ati2evxx.exe... Read more

A:win32.trojandownloader.alphabet shows up on Ad-aware SE

sorry, I guess I posted this in the wrong section (didn't see this forum). Still, can anyone assist me in getting rid of this?

Read other 3 answers


Kind of you to help me.

I use avast as a virusscanner and every minute it keeps saying I have a virus...Win32:Alphabet-P [Trj] and the file name changes everytime.

this is an example: C:\Program Files\5368140.exe\[PECompact]

Hereby also the deckard's system scan.

I would be very greatfull if someone could help with this problem.

thanks in advance.

best regards.

Deckard's System Scanner v20071014.68
Run by - on 2008-01-31 22:17:15
Computer is in Normal Mode.

-- System Restore --------------------------------------------------------------

Successfully created a Deckard's System Scanner Restore Point.

-- Last 5 Restore Point(s) --
38: 2008-01-31 21:17:27 UTC - RP667 - Deckard's System Scanner Restore Point
37: 2008-01-31 20:12:41 UTC - RP666 - Removed STOPzilla. Available with Windows Installer version 1.2 and later.
36: 2008-01-31 19:49:29 UTC - RP665 - Last known good configuration
35: 2008-01-31 19:49:25 UTC - RP664 - Uniblue RegistryBooster
34: 2008-01-31 19:49:25 UTC - RP663 - Uniblue RegistryBooster

-- First Restore Point --
1: 2008-01-31 19:49:06 UTC - RP630 - System Checkpoint

Backed up registry hives.
Performed disk cleanup.

-- HijackThis (run as -.exe) ---------------------------------------------------

Logfile of Trend Micro HijackThis v2.0.2
Scan saved at 22:20:40, on 31/01/2008
Platform: Windows XP SP2 (W... Read more

A:Win32:Alphabet-P [Trj] keeps appearing every minute... have deckards scan

Hello and Welcome. Apologies for any delay in replying, but we have been rather busy lately.

Please subscribe to this thread to get immediate notification of replies as soon as they are posted. To do this click Thread Tools, then click Subscribe to this Thread. Make sure it is set to Instant Notification, then click Subscribe.

If you're not receiving help elsewhere, and still require assistance for this issue, and since it has been a few days since you first posted, please do this:

Run Deckard's System Scanner once more, and post it's log.


Thank you.

Read other 10 answers

Just yesterday I appear to have found contracted a virus. No matter what method I use to remove it, everytime I restart my computer, it is back. Hopefully someone will be able to help me. Per Ad-Ware, this is what was found:
Trojan.Win32.Generic!BT - c:\windows\system32\d-link_st3402.dll
Win32.Trojan.Agent - c:\windows\system32\d-link_st3402.dll

I ran the MiniToolBox and have attached the results of that. I tried running going into safe mode and running RKill, then SAS, then rebooting into normal mode and running MBAN but it always seems to come back. I also attached the MBAN log as well.

I hope someone can help, otherwise it looks like a long night of reformatting is ahead of me......

A:Infected with Trojan.Win32.Generic!BT & Win32.Trojan.Agent

Since we're dealing here with ZeroAccess rootkit....Please follow the instructions in ==>This Guide<== starting at Step 6. If you cannot complete a step, skip it and continue.Once the proper logs are created, then make a NEW TOPIC and post it ==>HERE<== Please include a description of your computer issues, what you have done to resolve them, and a link to this topic.If you can produce at least some of the logs, then please create the new topic and explain what happens when you try to create the log(s) that you couldn't get. If you cannot produce any of the logs, then still post the topic and explain that you followed the Prep. Guide, were unable to create the logs, and describe what happens when you try to create the logs.It would be helpful if you post a note here once you have completed the steps in the guide and have started your topic in malware removal. Good luck and be patient.If HelpBot replies to your topic, PLEASE follow Step One so it will report your topic to the team members.

Read other 1 answers

I have a nasty infection that has taken over my machine and which I cannot remove. The infection seems to hijack the google page and any links that I click from this page take me to what appears to be rogue websites, which want me to download their stuff.

I am currently running ESET Nod 32 and Ad-aware Anniversary Edition. Both these programs are picking up the trojan infections but are unable to clean.

I have tried to install malwarebytes but have been unable to do so. I did try changing the exe name of malwarebytes (as advised on this site) but the program does not fully complete the installation.

I have downloded the DDS tool, ran the scan and have now attached the lod to this post.

Also here is a copy of the Ad-aware scan log (I did not complete the scan due to the computer constantly crashing):

Logfile created: 10/06/2009 18:19:4
Lavasoft Ad-Aware version: 8.0.5
Extended engine version: 8.1
User performing scan: SYSTEM

*********************** Definitions database information ***********************
Lavasoft definition file: 148.49
Extended engine definition file: 8.1

******************************** Scan results: *********************************
Scan profile name: Smart Scan (ID: smart)
Objects scanned: 70104
Objects detected: 7
Type Detected
Processes.......: 1
Registry entries: 0
Hostfile entries: 0
Files...........: 6
Folders.........: 0
LSPs............: 0
Cookies............ Read more

A:Infected with WIN32 Trojan Agent and WIN32 trojan TDSS

Hello. I am PropagandaPanda (Panda or PP for short), and I will be helping you.Disable Realtime ProtectionAntimalware programs can interfere with ComboFix and other tools we need to run. Please temporarily disable all realtime protections you have enabled. Refer to this page, if you are unsure how.Download and Run ComboFixDownload Combofix by sUBs from any of the links below, and save it to your desktop.Link 1, Link 2, Link 3 Close/disable all anti-virus and anti-malware programs so they do not interfere with the running of ComboFix. Refer to this page if you are not sure how.Double click on ComboFix.exe and follow the prompts. If you are using Windows Vista, right click the icon and select "Run as Administrator". You will not recieve the prompts below if you are not using Windows XP. ComboFix will check to see if you have the Windows Recovery Console installed.If you did not have it installed, you will see the prompt below. Choose YES.
When the Recovery Console has been installed, you will see the prompt below. Choose YES.
When finished, ComboFix will produce a report for you. Please post the contents of the log (C:\ComboFix.txt).Leave your computer alone while ComboFix is running. ComboFix will restart your computer if malware is found; allow it to do so.Download and Run Scan with GMERWe will use GMER to scan for rootkits.Please download GMER to your desktop. Note that the file will be randomly named to prevent active malware from stopping the download.Close all other ope... Read more

Read other 7 answers


I am on a laptop running Windows 7 and a couple of days ago, Ad-aware found two viruses: Trojan.Win32.Generic!BT & Win32.Trojan.Agent - see details on quarantined items pasted at the bottom of this note. I've tried numerous times to remove the viruses by rebooting, as recommended, and rescanning, but it's only gotten worse. I can now no longer access most of my programs, including any virus scan programs (Adaware, Malwarebytes). I was able to download RKill but when I try to run any of the different versions nothing happens - have tried renaming with no sucess. When using Internet Explorer, Google search is redirected to other sites. I've tried using safe mode with the same results.

Please let me know if you can help? Here's the virus scan log from a few days ago, when I was actually able to run Adaware.

Thanks in advance!!

Scan Log:

Quarantined items:
Description: c:\programdata\f4d55f3b0001577a000a86a2b4eb2367\f4d55f3b0001577a000a86a2b4eb2367.exe Family Name: Trojan.Win32.Generic!BT Engine: 3 Clean status: Success Item ID: 1 Family ID: 0 MD5: 7f544794965c873108012225055eafd6
Description: c:\windows\assembly\gac_32\desktop.ini Family Name: Trojan.Win32.Generic!BT Engine: 3 Clean status: Reboot required Item ID: 1 Family ID: 0 MD5: 878F9B6DA85CB98FCBDF6ABD1730A32F
Description: c:\windows\assembly\temp\u\[email protected] Family Name: Trojan.Win32.Generic!BT Engine... Read more

A:Infected with Trojan.Win32.Generic!BT & Win32.Trojan.Agent

Hello, let see if we can do these.If RKill still fails ,move on.Please click Start > Run, type inetcpl.cpl in the runbox and press enter.Click the Connections tab and click the LAN settings option.Verify if "Use a proxy..." is checked, if so, UNcheck it and click OK/OK to exit.Please download MiniToolBox, save it to your desktop and run it. Checkmark the following checkboxes: Flush DNS Report IE Proxy Settings Reset IE Proxy Settings Report FF Proxy Settings Reset FF Proxy Settings List content of Hosts List IP configuration List Winsock Entries List last 10 Event Viewer log List Installed Programs List Devices List Users, Partitions and Memory size. List Minidump FilesClick Go and post the result (Result.txt). A copy of Result.txt will be saved in the same directory the tool is run. Note: When using "Reset FF Proxy Settings" option Firefox should be closed.Reboot into Safe Mode with Networking How to enter safe mode(XP/Vista)Using the F8 MethodRestart your computer. When the machine first starts again it will generally list some equipment that is installed in your machine, amount of memory, hard drives installed etc. At this point you should gently tap the F8 key repeatedly until you are presented with a Windows XP Advanced Options menu. Select the option for Safe Mode with Networking using the arrow keys. Then press enter on your keyboard to boot into Safe Mode. >>>> Download this file and doubleclick on it to run it. Allow the informat... Read more

Read other 15 answers

I have been clearing a computer from numerous infections. I uninstalled the outdated (since 2006) McAfee AV. I have installed Microsoft Security Essentials, MBAM, and SuperAntiSpyware. I used this combination as well as several online scanners to remove over 150 infections. Every time I run a scan with SAS, the log comes back with the following infections:Trojan.Dropper/SVCHost-FakeC:\SYSTEM VOLUME INFORMATION\_RESTORE{D5FFFA500B1B}\SVCHOST.EXEC:\SYSTEM VOLUME INFORMATION\_RESTORE{D5FFFA500B1B}\SVCHOST.EXETrojan.Agent/Gen-FakeAlertC:\SYSTEM VOLUME INFORMATION\_RESTORE{D5FFFA500B1B}\SMSS.EXEC:\SYSTEM VOLUME INFORMATION\_RESTORE{D5FFFA500B1B}\SMSS.EXEMicrosoft Security Essentials pops up during the scan with the following infection:Trojan Downloader: Win32/Unruy.D C:\SYSTEM VOLUME INFORMATION\_RESTORE{D5FFFA500B1B}\SMSS.EXE I created a new restore point and deleted all previous points, yet these infections still remain. I was receiving help from another moderator who had me try several things before directing me here. Topic referenced is here: http://www.bleepingcomputer.com/forums/t/318510/cannot-remove-trojan/ ~ OB I am posting the DDS log, GMER log, and attaching the attach.txt file. Thank you in advance for any and all help you can provide. DDS (Ver_10-03-17.01) - NTFSx86 Run by Phillips at 14:21:21.10 on Tue 05/25/2010Internet Explorer: 8.0.6001.18702Microsoft Windows XP Home Edition 5.1.2600.3.1252.1.1033.18.1278.796 [GMT -4:00]AV: Microsoft Security Essentials *... Read more

A:Infected with: Trojan.Dropper/SVCHost-Fake,Trojan.Agent/Gen-FakeAlert, & Trojan Downloader: Win32/Unruy.D.

Hello and welcome to Bleeping ComputerWe apologize for the delay in responding to your request for help. Here at Bleeping Computer we get overwhelmed at times, and we are trying our best to keep up. Please note that your topic was not intentionally overlooked. Our mission is to help everyone in need, but sometimes it takes just a little longer to get to every request for help. No one is ignored here.If you have since resolved the original problem you were having, we would appreciate you letting us know. If not please perform the following steps below so we can have a look at the current condition of your machine. If you have not done so, include a clear description of the problems you're having, along with any steps you may have performed so far.Upon completing the steps below another staff member will review and take the steps necessary with you to get your machine back in working order clean and free of malware.If you have already posted a DDS log, please do so again, as your situation may have changed.Use the 'Add Reply' and add the new log to this thread.Thanks and again sorry for the delay.We need to see some information about what is happening in your machine. Please perform the following scan:Download DDS by sUBs from one of the following links. Save it to your desktop.DDS.scrDDS.pifDouble click on the DDS icon, allow it to run.A small box will open, with an explaination about the tool. No input is needed, the scan is running.Notepad will open with the results.Foll... Read more

Read other 19 answers

hi all i am infected by Trojan.Win32.ZbotPatched.d @Trojan/[email protected] Heuristic.BehavesLike.Win32.Virus.I i tried to remove but no luck . its a pain i hope u can help before i reformat drive. kaspersky found the file said had to restart to remove. on restart scan it found same trojans now in a different exe. i am running vista 32 home premium any help is greatly appreciated ty. Antivirus Version Last Update Result
a-squared 2010.07.08 -
AhnLab-V3 2010.07.08.00 2010.07.07 -
AntiVir 2010.07.07 -
Antiy-AVL 2010.07.07 -
Authentium 2010.07.08 -
Avast 4.8.1351.0 2010.07.07 -
Avast5 5.0.332.0 2010.07.07 -
AVG 2010.07.08 -
BitDefender 7.2 2010.07.08 -
CAT-QuickHeal 11.00 2010.07.07 -
ClamAV 2010.07.08 -
Comodo 5354 2010.07.08 -
DrWeb 2010.07.08 -
eSafe 2010.07.07 -
eTrust-Vet 36.1.7691 2010.07.07 -
F-Prot 2010.07.07 -
F-Secure 9.0.15370.0 2010.07.08 -
Fortinet 2010.07.07 -
GData 21 2010.07.08 -
Ikarus T3. 2010.07.08 -
Jiangmin 13.0.900 2010.07.07 -
Kaspersky 2010.07.08 Trojan.Win32.ZbotPatched.d
McAfee 5.400.0.1158 2010.07.08 -
McAfee-GW-Edition 2010.1 2010.07.05 Heuristic.BehavesLike.Win32.Virus.I
Microsoft... Read more

A:infected by Trojan.Win32.ZbotPatched.d, Trojan/W32.ZbotPatched.380928 , Heuristic.BehavesLike.Win32.Virus

Refrain from posting logs without being asked to post a log...

Run a scan with Malwarebytes Anti Malware ( A full scan, make sure you download install and update malwarebytes anti malware, before attempting to scan with it ;) )

You dont have allll those anti viruses on your computer at once, do you?

Read other 7 answers

Hello Bleeping!
A few days ago I removed Norton AV and installed MSSE. MSSE detected Trojan Dropper: Win32/Sirefef.B and Rogue:Win32/FakeRean. For the past two full system scans MSSE has detected and removed the dropper, and the last scan (last night) detected the Fake Rean. The MSSE removals don't appear to be effective against the dropper. Another peculiar thing, when I installed MSSE a few days ago, it told me my firewall was not up, but when I go into MS Security Center it says that the firewall is "ON". Not sure if perhaps the Norton AV removal maybe wasn't complete and that I am getting "false positives", or if something is really there. My logs are as follows:

DDS (Ver_2011-08-26.01) - NTFSx86
Internet Explorer: 7.0.5730.13 BrowserJavaVersion: 1.6.0_30
Run by Eric at 16:37:09 on 2012-02-09
Microsoft Windows XP Professional 5.1.2600.3.1252.1.1033.18.3069.2216 [GMT -5:00]
AV: Microsoft Security Essentials *Enabled/Updated* {EDB4FA23-53B8-4AFA-8C5D-99752CCA7095}
============== Running Processes ===============
C:\WINDOWS\system32\svchost.exe -k DcomLaunch
c:\Program Files\Microsoft Security Client\Antimalware\MsMpEng.exe
C:\Program Files\Trusteer\Rapport\bin\RapportMgmtService.exe
C:\WINDOWS\System32\svchost.exe -k netsvcs
C:\WINDOWS\system32\svchost.exe -k WudfServiceGroup
C:\WINDOWS\syste... Read more

A:Infected with Trojan Dropper: Win32/Sirefef.B AND Rogue: Win32 Fake Rean

Hello and Welcome to the forums! My name is Gringo and I'll be glad to help you with your computer problems. Somethings to remember while we are working together.Do not run any other tool untill instructed to do so!please Do not Attach logs or put in code boxes.Tell me about any problems that have occurred during the fix.Tell me of any other symptoms you may be having as these can help also.Do not run anything while running a fix.Do not run any other tool untill instructed to do so!Click on the Watch Topic Button and select Immediate Notification and click on proceed, this will help you to get notified faster when I have replied and make the cleaning process faster.Please print out or make a copy in notpad of any instructions given, as sometimes it is necessary to go offline and you will lose access to them.Run Combofix:You may be asked to install or update the Recovery Console (Win XP Only) if this happens please allow it to do so (you will need to be connected to the internet for this)Before you run Combofix I will need you to turn off any security software you have running, If you do not know how to do this you can find out >here< or >here<Combofix may need to reboot your computer more than once to do its job this is normal.You can download Combofix from one of these links.Link 1Link 2Link 3 1. Close any open browsers or any other programs that are open.2. Close/disable all anti virus and anti malware programs so they do not interfere with the r... Read more

Read other 18 answers

Hello, I was told to post here by the moderator. Here's the scoop: I was infected with a virus and didn't have any protection on my PC. I went out and bought Kaspersky Internet Security 2009. My original problem was that the virus was not allowing me to surf the internet with out popups and redirects. After running the Kaspersky software it cleaned up a bunch of issues but has gotten to a point were it cannot clean the last two issues. It recognizes them and marks them for deletion but asks me to reboot in order to delete. After I reboot it just finds the viruses again and I repeat the process endlessly.

I went through some troubleshooting steps with a Kaspersky rep and she decided that she had exhausted all options and asked me to format the computer. That is not an option and I don't believe that there is no hope of cleaning the virus. I am in need of someone with a little more expertise and vigilance.

The two issues are described below as listed by the Kaspersky software:
1. Trojan-Cliker.win32.delf.cbe - Object: C:\windows\system32\gznvqkei.dll
2. Rootkit.win32.Podnuha.a - Object: System Memory

When I try to manually delete the gznvqkei.dll file I get an "Access Denied" error.

The Kaspersky rep did have me run the combofix software but it did not solve the issue. She had me run a custom script from within the AV software that was designed to delete the troubled files to no avail. She also had me create a boot disk but when using the boot d... Read more

A:2 Infected - Rootkit.win32.Podnuha.a and Trojan-Cliker.win32.delf.cbe

Hello dmacc01.If you still have the same issues, you may consider the following. But first, be absolutely aware that having the system without an antivirus program is an extremely dangerous thing.Let's have you create a restore point (at this time). 1. Right click the My Computer icon on the Desktop and click on Properties.2. Click on the System Restore tab.3. If there is a check mark next to "Turn off System Restore on all drives", then click on the line to clear it.4. If C is your system drive (as it is in most cases) and you see other drives monitored in the list (like D, E, etc) click on the other drives, press Settings button, and get the other drives turned off.5. we only want to monitor the drive with Windows o.s.If you are unable to activate System Restore or if the service is disabled, then.....from the Start button > RUN option .... type in services.msclook for System Restore serviceIf it is listed as off or inactive, press on the link at top left to Start it.Next, See and do as outlined here http://bertk.mvps.org/html/createrp.htmlAfter that, also do this:1. Go >> Here << and download ERUNT (ERUNT (Emergency Recovery Utility NT) is a free program that allows you to keep a complete backup of your registry and restore it when needed.)2. Install ERUNT by following the prompts (use the default install settings but say no to the portion that asks you to add ERUNT to the start-up folder, if you like you can enable this option later)3. Start ERUNT... Read more

Read other 4 answers

Hello!I have trouble with my computer. I found this forum online and now I hope that you can help me. I suspected that I had a virus so I installed a anti-virus program. It found files with the names virus.win32.sality.k and trojan-proxy.win32.agent.II on my computer. After desinfecting those files I always got an error message when I turned the computer on. It kept telling me: file vmmdiag32.exe cannot be found. Then I found this forum and saw that other people had the same problem and that this is still a consequence of the virus. I don?t know how to get rid of it.Then I found your preparation guide for use before posting a hijackthis log, and checked my computer with the programs you adviced. Now that errormessage has disappeared, but I have the impression that my computer doesn?t work properly anymore. It?s getting slower and the anti-virus programm always finds new infected files. Sometimes when I turn the computer on it gets stuck while it is booting up and I have to press F1 to continue.Now there?s a problem with the audio too - I don?t know if it is also a result of the virus. It tells me: bad directsound driver. please install proper drivers or select another device in configuration. error code: 88780078. and the only sound the computer makes is a terrible peep sound.I have never had a virus before (I didn?t have internet on my computer), so I?m a little bit helpless and I would really appreciate it if you could help me.I also did the Hijackthis. here is the res... Read more

A:Infected With: Virus.win32.sality.k; Trojan-proxy.win32.agent.ii

Hi schag1,

If you still need help please post a fresh HijackThis log and I'll be happy to look at it for you.

Thanks for your patience.

Read other 6 answers

I have already scanned and fixed my notebook for spywares using ad aware se and sbc yahoo! anti-spy. But i still got pop ups and system alerts saying that i have spywares on my computer and my internet explorer browser is still internet security. And everytime i run sbc yahoo! anti-spy, i always get the same spywares and when i click on remove all, it is removed but when i run it again, the scaan results is the same. Please help me. Attached is the copy of the log created using HijackThis. Thank you.Logfile of HijackThis v1.99.1Scan saved at 12:02:06 AM, on 7/5/2006Platform: Windows XP SP2 (WinNT 5.01.2600)MSIE: Internet Explorer v6.00 SP2 (6.00.2900.2180)Running processes:C:\WINDOWS\System32\smss.exeC:\WINDOWS\system32\winlogon.exeC:\WINDOWS\system32\services.exeC:\WINDOWS\system32\lsass.exeC:\WINDOWS\system32\svchost.exeC:\WINDOWS\System32\svchost.exeC:\WINDOWS\System32\WLTRYSVC.EXEC:\WINDOWS\System32\bcmwltry.exeC:\WINDOWS\system32\spoolsv.exeC:\WINDOWS\Explorer.EXEC:\WINDOWS\system32\dcomcfg.exeC:\WINDOWS\system32\atmclk.exeC:\Program Files\Apoint\Apoint.exeC:\WINDOWS\system32\hkcmd.exeC:\WINDOWS\system32\igfxpers.exeC:\WINDOWS\system32\WLTRAY.exeC:\Program Files\Dell\QuickSet\quickset.exeC:\Program Files ... Read more

A:Infected With Trojandownloader.win32.zlob.ci And Trojan.win32.startpage.adh And Spywarequake 2.0

You should print out these instructions, or copy them to a NotePad file for reading while in Safe Mode, because you will not be able to connect to the Internet to read from this site.Please download SmitfraudFix (by S!Ri)Extract the content (a folder named SmitfraudFix) to your Desktop.Next, please reboot your computer in Safe Mode by doing the following :Restart your computerAfter hearing your computer beep once during startup, but before the Windows icon appears, tap the F8 key continually;Instead of Windows loading as normal, a menu with options should appear;Select the first option, to run Windows in Safe Mode, then press "Enter".Choose your usual account.Once in Safe Mode, open the SmitfraudFix folder again and double-click smitfraudfix.cmdSelect option #2 - Clean by typing 2 and press "Enter" to delete infected files.You will be prompted: "Registry cleaning - Do you want to clean the registry?"; answer "Yes" by typing Y and press "Enter" in order to remove the Desktop background and clean registry keys associated with the infection.The tool will now check if wininet.dll is infected. You may be prompted to replace the infected file (if found); answer "Yes" by typing Y and press "Enter".The tool may need to restart your computer to finish the cleaning process; if it doesn't, please restart it into Normal Windows.A text file will appear onscreen, with results from the cleaning process; please copy/pa... Read more

Read other 5 answers

Hello, I was infected with a virus and didn't have any protection on my PC. I went out and bought Kaspersky Internet Security 2009. My original problem was that the virus was not allowing me to surf the internet with out popups and redirects. After running the Kaspersky software it cleaned up a bunch of issues but has gotten to a point were it cannot clean the last two issues. It recognizes them and marks them for deletion but asks me to reboot in order to delete. After I reboot it just finds the viruses again and I repeat the process endlessly.

I went through some troubleshooting steps with a Kaspersky rep and she decided that she had exhausted all options and asked me to format the computer. That is not an option and I don't believe that there is no hope of cleaning the virus. I am in need of someone with a little more expertise and vigilance.

The two issues are described below as listed by the Kaspersky software:
1. Trojan-Cliker.win32.delf.cbe - Object: C:\windows\system32\gznvqkei.dll
2. Rootkit.win32.Podnuha.a - Object: System Memory

When I try to manually delete the gznvqkei.dll file I get an "Access Denied" error.

The Kaspersky rep did have me run the combofix software but it did not solve the issue. She had me run a custom script from within the AV software that was designed to delete the troubled files to no avail. She also had me create a boot disk but when using the boot disk it does not recognize my hard drive so ... Read more

A:2 Infected - Rootkit.win32.Podnuha.a and Trojan-Cliker.win32.delf.cbe

Probably you best chance is to submit a HJT logPlease read the pinned topic titled "Preparation Guide For Use Before Posting A Hijackthis Log". If you cannot complete a step, then skip it and continue with the next. In Step 6 there are instructions for downloading and running DDS which will create a Pseudo HJT Report as part of its log.When you have done that, post your log in the HijackThis Logs and Malware Removal forum, NOT here, for assistance by the HJT Team Experts. A member of the Team will walk you through, step by step, on how to clean your computer. If you post your log back in this thread, the response from the HJT Team will be delayed because your post will have to be moved. This means it will fall in line behind any others posted that same day. Start a new topic, give it a relevant title and post your log along with a brief description of your problem, a summary of any anti-malware tools you have used and a summary of any steps that you have performed on your own. An expert will analyze your log and reply with instructions advising you what to fix. After doing this, we would appreciate if you post a link to your log back here so we know that your getting help from the HJT Team.Please be patient. It may take a while to get a response because the HJT Team members are very busy working logs posted before yours. They are volunteers who will help you out as soon as possible. Once you have made your post and are waiting, please DO NOT "bump" your post or make another r... Read more

Read other 3 answers

Hi guys need some urgent help....i have AVG 8.5.427 free edition installed on my system ,wherein the operating system is Windows XP Profesional .....i ran a scan on my system and the scan reported Trojan Horse Generic11.ATHC and the resident shield log reported the remaining viruses(Worm/Downadup,Win32/Virut,Win32/Cryptor).I deleted the corresponding folders but still the system is very slow.It would be of immense help if anybody could provide expert advice on this matter.I am providing the hijackthis log herewithLogfile of Trend Micro HijackThis v2.0.2[/u][/u]Scan saved at 4:18:32 PM, on 12/21/2009Platform: Windows XP SP2 (WinNT 5.01.2600)MSIE: Internet Explorer v6.00 SP2 (6.00.2900.2180)Boot mode: NormalRunning processes:C:\WINDOWS\System32\smss.exeC:\WINDOWS\system32\winlogon.exeC:\WINDOWS\system32\services.exeC:\WINDOWS\system32\lsass.exeC:\WINDOWS\system32\svchost.exeC:\WINDOWS\System32\svchost.exeC:\WINDOWS\system32\spoolsv.exeC:\PROGRA~1\AVG\AVG8\avgwdsvc.exeC:\WINDOWS\Explorer.EXEC:\PROGRA~1\AVG\AVG8\avgemc.exeC:\PROGRA~1\AVG\AVG8\avgrsx.exeC:\PROGRA~1\AVG\AVG8\avgnsx.exeC:\Program Files\AVG\AVG8\avgcsrvx.exeC:\WINDOWS\system32\ctfmon.exeC:\Program Files\CleanMyPC\Registry Cleaner\RCHelper.exeC:\WINDOWS\system3... Read more

A:Infected with Trojan horse generic11,Worm/Downadup,Win32/Virut,Win32/Cryptor

Welcome to the BleepingComputer Forums. Since it has been a few days since you scanned your computer with HijackThis, we will need a new HijackThis log. If you have not already downloaded Random's System Information Tool (RSIT), please download Random's System Information Tool (RSIT) by random/random which includes a HijackThis log and save it to your desktop. If you have RSIT already on your computer, please run it again. Double click on RSIT.exe to run RSIT. Click Continue at the disclaimer screen. Please post the contents of log.txt. Thank you for your patience.Please see Preparation Guide for use before posting about your potential Malware problem. If you have already posted this log at another forum or if you decide to seek help at another forum, please let us know. There is a shortage of helpers and taking the time of two volunteer helpers means that someone else may not be helped. Please post your HijackThis log as a reply to this thread and not as an attachment. I am always leery of opening attachments so I always request that HijackThis logs are to be posted as a reply to the thread. I do not think that you are attaching anything scary but others may do so. While we are working on your HijackThis log, please: Reply to this thread; do not start another! Do not make any changes on your computer during the cleaning process or download/add programs on your computer unless instructed to do so. Do not run any other tool until ... Read more

Read other 3 answers

hi, my sister recieved an email from her fellow student mate and thought it was crucial and as soon as she opened the email she started to experience anti malware doctor software pop up saying you have recieved threats click yes to remove and so on. ive tried to uninstall that program from safe but it comes back again everytime i log on to desktop. also my avg 9 is picking up loads of the trojan horse cryptic.apo file in the temp folder but canot delete it , it says " interupted by user" and keeps multiplying. i cant seem to surf the net on windows explorer it says page unavilible but i can go online with skype and other messengers. the anti malware doctor pops up every now and then. just cant seem to remove the trojans and anti malware doctor software. ive tried anti malwarebyte in safe mode it found few objects but after restarting to desktop the anti malware doctor automatically installed again on the laptop. ----------------------------------DDS (Ver_10-03-17.01) - NTFSX64 Run by vedika at 1:45:44.03 on 20/07/2010Internet Explorer: 8.0.6001.18928Microsoft? Windows Vista? Home Premium 6.0.6001.1.1252.44.1033.18.2006.619 [GMT 2:00]SP: Windows Defender *enabled* (Updated) {D68DDC3A-831F-4FAE-9E44-DA132C1ACF46}SP: SUPERAntiSpyware *disabled* (Updated) {222A897C-5018-402e-943F-7E7AC8560DA7}============== Running Processes ===============C:\Windows\system32\wininit.exeC:\Program Files (x86)\AVG\AVG9\avgchsva.exeC:\Program Files (x86)\AVG\AVG9\avgrsa.exeC:\Windows\... Read more

A:infected with anti malware doctor with trojan horse cryptic.apo and win32/psw.wow.now and win32. fraudpack. bagn

Hello and Welcome to the forums! My name is Gringo and I'll be glad to help you with your computer problems. Somethings to remember while we are working together.Do not run any other tool untill instructed to do so!Please Do not Attach logs or put in code boxes.Tell me about any problems that have occurred during the fix.Tell me of any other symptoms you may be having as these can help also.Do not run anything while running a fix.In the upper right hand corner of the topic you will see a button called Options. If you click on this in the drop-down menu you can choose Track this topic. By doing this and then choosing Immediate E-Mail notification and then clicking on Proceed you will be advised when we respond to your topic and facilitate the cleaning of your machine.We apologize for the delay in responding to your request for help. Here at Bleeping Computer we get overwhelmed at times, and we are trying our best to keep up. Please note that your topic was not intentionally overlooked. Our mission is to help everyone in need, but sometimes it takes just a little longer to get to every request for help. No one is ignored here.In order for me to see the status of the infection I will need a new set of logs to start with.Please print out or make a copy in notpad of any instructions given, as sometimes it is necessary to go offline and you will lose access to them.DeFogger: Please download DeFogger to your desktop.Double click DeFogger to run the tool. The ap... Read more

Read other 3 answers

Hi, Below is the log of the HijackThis which I ran as per the instructions on your website. I am currently running spydoctor which finds the infected files and apparently fixes them, but then they return almost immediately. I run ZoneAlarm firewall and AVG antivirus along with aol, if that helpsPlease help as this is driving me mad Logfile of HijackThis v1.99.1Scan saved at 20:16:06, on 04/05/2006Platform: Windows XP SP2 (WinNT 5.01.2600)MSIE: Internet Explorer v6.00 SP2 (6.00.2900.2180)R0 - HKLM\Software\Microsoft\Internet Explorer\Main,Start Page = http://news.bbc.co.uk/2/hi/uk_news/default.stmR0 - HKCU\Software\Microsoft\Internet Explorer\Main,Local Page = R0 - HKLM\Software\Microsoft\Internet Explorer\Main,Local Page = R3 - URLSearchHook: AOLTBSearch Class - {EA756889-2338-43DB-8F07-D1CA6FB9C90D} - C:\Program Files\AOL\AOL Toolbar 2.0\aoltb.dll (file missing)O2 - BHO: (no name) - {b0398eca-0bcd-4645-8261-5e9dc70248d0} - C:\WINDOWS\system32\hpEC05.tmp (file missing)O3 - Toolbar: AOL Toolbar - {DE9C389F-3316-41A7-809B-AA305ED9D922} - C:\Program Files\AOL\AOL Toolbar 2.0\aoltb.dll (file missing)O3 - Toolbar: (no name) - {4982D40A-C53B-4615-B15B-B5B5E98D167C} - (no file)O3 - Toolbar: &Google - {2318C2B1-4965-11d4-9B18-009027A5CD4F} - c:\program files\google\googletoolbar2.dllO4 - HKLM\..\Run: [TkBellExe] "C:\Program Files... Read more

A:Infected With Trojandownloader.win32.zlob.ci & Trojan.win32.startpage.adh

Hello,Your previous log is not complete... I am missing the running processes part, so make sure you are running HijackThis from a permanent folder and not from a temp folder.It's better to print out the next instructions or save them in notepad, because you also have to work in safe mode without networking support, so this page wouldn't be available then.It is also important you don't miss a step and perform everything in the right order!!* Please download SmitfraudFix (by S!Ri)Extract the content (a folder named SmitfraudFix) to your Desktop.Don't use it yet.* Reboot into Safe Mode`: ( without networking support !)?To get into the Safe mode as the computer is booting press and hold your "F8 Key". Use your arrow keys to move to "Safe Mode" and press your Enter key.* Start HijackThis, close all open windows leaving only HijackThis running. Place a check against each of the following if still present:R0 - HKCU\Software\Microsoft\Internet Explorer\Main,Local Page =R0 - HKLM\Software\Microsoft\Internet Explorer\Main,Local Page =R3 - URLSearchHook: AOLTBSearch Class - {EA756889-2338-43DB-8F07-D1CA6FB9C90D} - C:\Program Files\AOL\AOL Toolbar 2.0\aoltb.dll (file missing)O2 - BHO: (no name) - {b0398eca-0bcd-4645-8261-5e9dc70248d0} - C:\WINDOWS\system32\hpEC05.tmp (file missing)O3 - Toolbar: AOL Toolbar - {DE9C389F-3316-41A7-809B-AA305ED9D922} - C:\Program Files�... Read more

Read other 2 answers

I use ESET NOD32. At startup it detects the win32/Kryptik in a start-up scan and later mentions the Win32 rootkit running in memory. The scan log shows that it has detected this on each startup but it cannot delete because files are locked from removal. I have not been able to tell what file NOD is trying to find. Below is last log file post: This same message is repeated in numerous 10+ restarts in the past 24 hours.

5/19/2009 8:25:51 PM Startup scanner file \\?\globalroot\systemroot\system32\gxvxctxujtymqsiltimrpcilnqyirvmqgrlhk.dll a variant of Win32/Kryptik.PF trojan cleaned by deleting (after the next restart) - quarantined
5/19/2009 8:25:46 PM Startup scanner operating memory Operating memory Win32/Rootkit.Agent.ODG trojan unable to clean

I have run ESET in safe mode. It didnot do anything to eliminate the problem. Windows Defender has apparently not done anything either. Finally, I tried windows malicious software removal, but apparently it could not do anything either.

Main problem I notice is delays in internet usage. Happens both in firefox and ie. I changed DNS settings from automatically detect to a fixed DNS setting from earthlink.net. Still same slow down in internet usage.

Appreciate any help you can give. I have tried to find bad file, but to no avail.


DDS (Ver_09-05-14.01) - NTFSx86
Run by Pop at 21:38:42.70 on Tue 05/19/2009
Internet Explorer: 7.0.... Read more

A:Infected with Win32/Krptik.PF and win32/Rootkit.agent.odg.trojan

It now looks like I may have been able to repair my problem. I used a somewhat, haphazard, unguided approach to removal. The final solution came from AVG Rootkit removal ( http://download.cnet.com/AVG-Anti-Rootkit-...4-10662685.html ). Here is a list of all the steps I attempted. I was worried at times I could have hurt my system, but then I would have had to reinstall the OS. But, on the other hand, some internet posts I read were saying that was the only way to repair the situation. So, desperation took hold. I found my reinstall disks, just in case I needed them and proceeded. ATF Cleaner -- Who needs temp files anyway, especially if they might have trojans, I eliminated temp files this program would find.CC Cleaner - used this to clean out internet cache and history.Recycler folders - I had multiple recycler folders, one that had a rundll in it. I assumed you only have one recycle bin so you only need one of these folders. I had to reset the folder view options in exlorer to see all files and folders (hidden, system, etc.) I deleted the extra recycler folders I could find.System Restore - I turned off system restore. This would erase all the previous positions I had saved. This meant I could never go back to a prior position where my computer was running good, but I didn't know how to find out if I had virus/trojan in one of these saved files I then immediately turned back on the system restore after the old restore files were deleted.b]Windows defender[... Read more

Read other 2 answers

My computer is infected by the Win32:Trojan-gen and Win32:Trojano-3238 viruses.
There were detected by theAvast! antivirus and this one cannot do nothing: not delete the infected files, nor repair them or "move them to the chest".
Does anyone know how to repair this infection?

A:Infected by Win32:Trojan-gen and Win32:Trojano-3238 Viruses

Please download Malwarebytes Anti-Malware and save it to your desktop.Make sure you are connected to the Internet.Double-click on mbam-setup.exe to install the application.When the installation begins, follow the prompts and do not make any changes to default settings.When installation has finished, make sure you leave both of these checked:Update Malwarebytes' Anti-MalwareLaunch Malwarebytes' Anti-MalwareThen click Finish.MBAM will automatically start and you will be asked to update the program before performing a scan. If an update is found, the program will automatically update itself. Press the OK button to close that box and continue. If you encounter any problems while downloading the updates, manually download them from here and just double-click on mbam-rules.exe to install.On the Scanner tab:Make sure the "Perform Quick Scan" option is selected.Then click on the Scan button.If asked to select the drives to scan, leave all the drives selected and click on the Start Scan button. The scan will begin and "Scan in progress" will show at the top. It may take some time to complete so please be patient.When the scan is finished, a message box will say "The scan completed successfully. Click 'Show Results' to display all objects found".Click OK to close the message box and continue with the removal process.Back at the main Scanner screen, click on the Show Results button to see a list of any malware that was found.Make sure that e... Read more

Read other 1 answers

My computer is infected with Win32.Trojan.Tdss and Win32.TrojanDownloader.Agent. I've been trying to remove them with Ad-Aware but they re-install themselves. I've downloaded numorous other malware removers but the malware seems to disrupt / won't allow them to install or work. This includes the root repeal program mentioned in the preparation guide. When I attempt to run root repeal I get the following error:

04:03:06: FOPS - DeviceIoControl Error! Error Code = 0xc0000024 Extended Info (0x000000d8)
04:03:06: DeviceIoControl Error! Error Code = 0x1e7
04:03:06: FOPS - DeviceIoControl Error! Error Code = 0xc0000024 Extended Info (0x000000d8)

The most annoying thing that is happening is when I go to google something, it will redirect me to somewhere else or will throw random pop-ups at me every now and then. Also, I tried to reformat / re-install a fresh copy of Windows Vista but it seems this piece of malware makes it impossible to boot from disk.

Thank you in advance for your assistance!

Attached below is my dds.txt log:

DDS (Ver_09-07-30.01) - NTFSx86
Run by Jeff at 3:59:19.84 on Fri 08/28/2009
Internet Explorer: 7.0.6000.16890
Microsoft? Windows Vista???? Home Premium 6.0.6000.0.1252.1.1033.18.2046.1362 [GMT 9:00]

SP: Lavasoft Ad-Watch Live! *disabled* (Updated) {67844DAE-4F77-4D69-9457-98E8CFFDAA22}
SP: Windows Defender *enabled* (Updated) {D68DDC3A-831F-4FAE-9E44-DA132C1ACF46}

============== Running Processes ===============

C:\... Read more

A:Infected With Win32.Trojan.Tdss and Win32.TrojanDownloader.Agent

Hello and welcome to Bleeping ComputerWe apologize for the delay in responding to your request for help. Here at Bleeping Computer we get overwhelmed at times, and we are trying our best to keep up. Please note that your topic was not intentionally overlooked. Our mission is to help everyone in need, but sometimes it takes just a little longer to get to every request for help. No one is ignored here.If you have since resolved the original problem you were having, we would appreciate you letting us know. If not please perform the following steps below so we can have a look at the current condition of your machine. If you have not done so, include a clear description of the problems you're having, along with any steps you may have performed so far.Upon completing the steps below another staff member will review and take the steps necessary with you to get your machine back in working order clean and free of malware.If you have already posted a DDS log, please do so again, as your situation may have changed.Use the 'Add Reply' and add the new log to this thread.Thanks and again sorry for the delay.We need to see some information about what is happening in your machine. Please perform the following scan:Download DDS by sUBs from one of the following links. Save it to your desktop.DDS.scrDDS.pifDouble click on the DDS icon, allow it to run.A small box will open, with an explaination about the tool. No input is needed, the scan is running.Notepad will open with the results.Foll... Read more

Read other 3 answers

Hi. I know we have been badly infected lately. I ran malwarebytes - it found 3 trojan vundo and a trojan alphabet. The vundos were removed, the alphabet will not remove.
As of yesterday - internet explorer just disappeared. It says it was deleted, and we can not go to any desktop icons that were apparently associated with explorer. It says "The file does not have a program associated with it to perform this action. Create an association in the folder options control panel."
Please help

I want to add - I ran MBAM today several times. When checking my logs from previous trend micro threats stopped there were trojan fake alert, downloader, agent, BHO, and several rogues.
As I said MBAM got rid of others, but for alphabet it says delete on reboot. When I click "yes - restart" it does nothing. I restart manually, but nothing happens.
I tried uninstalling MBAM as I had read previously somewhere to reinstall it - I can't even get to the install page. Everything I try to go to says "oops could not find" whatever page I am trying to get to.

A:Trojan Alphabet

Never mind - geeks to go cleared me right up. Thanks anyway

Read other 1 answers

m ades, windows xp sp3
to whomever can help- i tried to remove some viruses
using info from bleeping, but am not having any luck.

i downloaded a file that i thought could help me on another
matter, but it had a virus that zone alarm's active scan did not

it was a rootkit virus. i tried tdsskiller several times as well as
malwarebytes, and thought i finally got rid of it. then another
virus popped up despite my not having connected to the internet.

another was this patch virus that kept redirecting my opera
browser. malwarebytes did not see this, but zone alarm did.
i tried to get rid of it and used tdsskiller, and thought i did.
i had to keep switching between safe mode and
normal mode to do it. i had no problems for two weeks, then
both seemed to pop up again. my guess is that i never
actually got rid of them. i tried zone alarm, malwarebytes,
and tdsskiller over and over again, with no luck. then my
ability to connect to the net went away. i gave up and restored
my hdd using the file i made just after i thought i had gotten
rid of the problems, so that though i would still have the viruses,
i would get back the net. using tdsskiller and malwarebytes
still did not work, and a new virus showed up. .

i'm including the logs from zone alarm, malwarebytes, and tdsskiller.

i would really appreciate help.

first to show up. used tdsskiller, seemed to be removed, kept showing back up.

(Forged): C:\WINDOWS\system32... Read more

A:infected with Rootkit.Win32.ZAccess.e, HiddenFile.Multi.Generic, Trojan.Win32.Patched.mf,, Backdoor.Agent.Gen) -> Value: Sh...

ps i have mbam, zone alarm,tdss,
and hijack logs, but was not sure
how to post them since the number
of text characters on this page
was limited.

Read other 70 answers

Hello and Welcome to the forums! My name is Gringo and I'll be glad to help you with your computer problems. Somethings to remember while we are working together.Do not run any other tool untill instructed to do so!Please Do not Attach logs or put in code boxes.Tell me about any problems that have occurred during the fix.Tell me of any other symptoms you may be having as these can help also.Do not run anything while running a fix.We apologize for the delay in responding to your request for help. Here at Bleeping Computer we get overwhelmed at times, and we are trying our best to keep up. Please note that your topic was not intentionally overlooked. Our mission is to help everyone in need, but sometimes it takes just a little longer to get to every request for help. No one is ignored here.Click on the Watch Topic Button and select Immediate Notification and click on proceed, this will help you to get notified faster when I have replied and make the cleaning process faster.In order for me to see the status of the infection I will need a new set of logs to start with.Please print out or make a copy in notpad of any instructions given, as sometimes it is necessary to go offline and you will lose access to them.DeFogger: Please download DeFogger to your desktop.

Double click DeFogger to run the tool.
The application window will appear Click the Disable button to disable your CD Emulation drivers Click Yes to continue A 'Finished!' message will ap... Read more

A:Infected with: win32/olmarik trojan ; browser redirect (Google, bing, yahoo) ; variant of win32/injector.HCW and surely more th...

No problem, i saw you have lot of work here....Well... Logs:dds.txt.DDS (Ver_2011-06-12.02) - NTFSx86 Internet Explorer: 6.0.2900.2180 BrowserJavaVersion: 1.6.0_23Run by Administrador at 16:48:33 on 2011-06-29Microsoft Windows XP Professional 5.1.2600.2.1252.34.3082.18.2045.1175 [GMT -3:00].AV: ESET NOD32 Antivirus 4.0 *Disabled/Updated* {E5E70D32-0101-4F12-8FB0-D96ACA4F34C0}.============== Running Processes ===============.C:\ARCHIV~1\ENIGMA~1\SPYHUN~1\SH4SER~1.EXEC:\WINDOWS\system32\svchost -k DcomLaunchsvchost.exeC:\WINDOWS\System32\svchost.exe -k netsvcsC:\WINDOWS\system32\svchost.exe -k WudfServiceGroupsvchost.exeC:\WINDOWS\system32\spoolsv.exeC:\Archivos de programa\Apache Software Foundation\Apache2.2\bin\httpd.exeC:\Archivos de programa\Archivos comunes\Apple\Mobile Device Support\bin\AppleMobileDeviceService.exeC:\WINDOWS\system32\bgsvcgen.exeC:\Archivos de programa\Bonjour\mDNSResponder.exeC:\Archivos de programa\Apache Software Foundation\Apache2.2\bin\httpd.exeC:\Archivos de programa\ESET\ESET NOD32 Antivirus\ekrn.exeC:\Archivos de programa\Java\jre6\bin\jqs.exeC:\Archivos de programa\MySQL\MySQL Server 5.1\bin\mysqld.exeC:\WINDOWS\system32\nvsvc32.exeC:\WINDOWS\system32\PSISer... Read more

Read other 19 answers

Hi! My real-time Anti-virus protection filter (Eset Nod32) has registered som virus activity for the past couple of weeks that i cant seem to get rid of:2010-03-22 11:26:47 Real-time file system protection file I:\System Volume Information\_restore{9307B358-B690-49BE-8C17-30DE253AE1DB}\RP828\A0122539.exe probably a variant of Win32/Agent trojan cleaned by deleting - quarantined NT INSTANS\SYSTEM Event occurred on a file modified by the application: C:\WINDOWS\System32\svchost.exe.2010-03-22 10:34:42 Real-time file system protection file E:\System Volume Information\_restore{9307B358-B690-49BE-8C17-30DE253AE1DB}\RP828\A0123560.exe a variant of Win32/Kryptik.W trojan cleaned by deleting - quarantined NT INSTANS\SYSTEM Event occurred on a file modified by the application: C:\WINDOWS\System32\svchost.exe.2010-03-22 10:34:36 Real-time file system protection file I:\System Volume Information\_restore{9307B358-B690-49BE-8C17-30DE253AE1DB}\RP828\A0122537.exe probably a variant of Win32/Agent trojan cleaned by deleting - quarantined NT INSTANS\SYSTEM Event occurred on a file modified by the application: C:\WINDOWS\System32\svchost.exe.The files (same trojan /s but different executable names after each deletion, for ex: it varies between A0005757.exe, A0005757.inf and svchost.exe and so on) comes keep comming back after deletion of files in qurantine. The DDS l... Read more

A:Infected by Win32/Agent & Win32/kryptik.W Trojan

Hello and welcome to Bleeping ComputerWe apologize for the delay in responding to your request for help. Here at Bleeping Computer we get overwhelmed at times, and we are trying our best to keep up. Please note that your topic was not intentionally overlooked. Our mission is to help everyone in need, but sometimes it takes just a little longer to get to every request for help. No one is ignored here.If you have since resolved the original problem you were having, we would appreciate you letting us know. If not please perform the following steps below so we can have a look at the current condition of your machine. If you have not done so, include a clear description of the problems you're having, along with any steps you may have performed so far.Upon completing the steps below another staff member will review and take the steps necessary with you to get your machine back in working order clean and free of malware.If you have already posted a DDS log, please do so again, as your situation may have changed.Use the 'Add Reply' and add the new log to this thread.Thanks and again sorry for the delay.We need to see some information about what is happening in your machine. Please perform the following scan:Download DDS by sUBs from one of the following links. Save it to your desktop.DDS.scrDDS.pifDouble click on the DDS icon, allow it to run.A small box will open, with an explaination about the tool. No input is needed, the scan is running.Notepad will open with the results.Foll... Read more

Read other 3 answers

Hi I have been overrun with adware etc in the last month or so. Have run through the steps in your preperation guide. Any help much appreciated.Thanks DaveLogfile of HijackThis v1.99.1Scan saved at 12:59:22, on 16/01/2006Platform: Windows XP SP2 (WinNT 5.01.2600)MSIE: Internet Explorer v6.00 SP2 (6.00.2900.2180)Running processes:C:\WINDOWS\System32\smss.exeC:\WINDOWS\system32\winlogon.exeC:\WINDOWS\system32\services.exeC:\WINDOWS\system32\lsass.exeC:\WINDOWS\system32\svchost.exeC:\WINDOWS\System32\svchost.exeC:\WINDOWS\system32\spoolsv.exeC:\WINDOWS\Explorer.EXEC:\WINDOWS\system32\RUNDLL32.EXEC:\Program Files\Dell\AccessDirect\dadapp.exeC:\Program Files\Apoint\Apoint.exeC:\WINDOWS\System32\DSentry.exeC:\WINDOWS\system32\pctspk.exeC:\Program Files\Hewlett-Packard\HP Share-to-Web\hpgs2wnd.exeC:\Program Files\SMSC\Seticon.exeC:\Program Files\Common Files\Real\Update_OB\realsched.exeC:\Program Files\QuickTime\qttask.exeC:\Program Files\Roxio\Easy Media Creator 7\Drag to Disc\DrgToDsc.exeC:\Program Files\CA\eTrust EZ Armor\eTrust EZ Antivirus\CAVTray.exeC:\Program Files\CA\eTrust EZ Armor\eTrust EZ Antivirus\CAVRID.exeC:\Program Files�... Read more

A:Infected With Win32.delf.trojan.b And Win32.centim

Please print out or copy this page to Notepad. Make sure to work through the fixes in the exact order in which they are mentioned below. If there's anything that you don't understand, ask your question(s) before proceeding with the fixes.Step #1Please click: Start--> Control Panel--> Add or Remove Programs--> Uninstall (if found) any instances of:Daily Weather ForecastThen reboot your computer.Step #2Scan again with HijackThis and check the following items:O2 - BHO: metaspinner GmbH - {7C7A8947-5935-4430-AC0E-E7D04697414E} - C:\PROGRA~1\BUYERT~1\IEBUTT~2.DLL (file missing)O2 - BHO: metaspinner GmbH - {CD9B7762-DFBC-42B1-BB30-02A78287B456} - C:\PROGRA~1\BUYERT~1\IEBUTT~1.DLL (file missing)O2 - BHO: (no name) - {E3215F20-3212-11D6-9F8B-00D0B743919D} - (no file)O4 - HKLM\..\Run: [Daily Weather Forecast] C:\Program Files\Daily Weather Forecast\weather.exeAfter checking these items, close all browser windows except HijackThis and click "Fix checked".Step #3We need to make sure all hidden files are showing so please:Click Start.Open My Computer.Select the Tools menu and click Folder Options.Select the View tab.Under the Hidden files and folders heading select Show hidden files and folders.Uncheck the Hide file extensions for known types option.Uncheck the Hide protected operating system files (recommended) option.Click Yes to confirm.Click OK.Step #4Reboot Your System in Safe Mode:Restart the computer.As s... Read more

Read other 9 answers

I visited Yahoo Movies when I believe I was infected with win32.trojandownloader.alphabet.
I have used AdAware to try and remove but with no success. also tried Vundo.exe.

How do you get rid of this thing.


A:Trojan Downloader.alphabet

start herefollow all the instructions and post your log in the appropriate forum not herehope this helps good luck

Read other 1 answers

Hi. In the last two weeks, my computer has been bombarded by trojans. I've got McAfee firewall, etc., but some of these buggers managed to get through. I had to pay the McAfee techs to clean out the first one. And now, I keep getting a warning box from McAfee saying that a generic.dx trojan has been quarantined. I ran the Kaspersky scan and it found the two viruses mentioned above in the topic title. I also ran the hijackthis program. Oh, and I also ran the McAfee scan today and it came up clean. I don't know what to do. I'm a novice at this stuff. Would it be better to pay McAfee again to clean it out, pay Kaspersky or what? And is there a better security software than McAfee? I never got a Trojan warnings before 2 weeks ago. My McAfee subscription renewed itself 2 weeks ago -- to add insult to injury, while I was on the phone with the McAfee techs. I'd happily jettison it if I could find a better program. So, again, I don't know what to do. I'm a complete novice at this stuff. Any help y'all could give would be much appreciated. Deckard's System Scanner v20071014.68Run by Alison on 2008-05-30 18:53:13Computer is in Normal Mode.---------------------------------------------------------------------------------- System Restore --------------------------------------------------------------Successfully created a Deckard's System Scanner Restore Point.-- Last 5 Restore Point(s) --69: 2008-05-31 01:53:17 UTC - RP75 - Deckard's System Scanner Restore Point68: 2008-05-30 23:37:26 UT... Read more

A:Infected With Trojan-downloader.win32.vb.eqj And Trojan-psw.win32.wow.bam

moving it up.

can anybody help?

thanking you in advance.

Read other 3 answers