Over 1 million tech questions and answers.

Infected With Dropper.agent,logger.pcap.a,win32.generic.pws,win32.trojan.psw.delf And Win32.trojan.pws.onlinegames

Q: Infected With Dropper.agent,logger.pcap.a,win32.generic.pws,win32.trojan.psw.delf And Win32.trojan.pws.onlinegames

Hi, here is my problem. Everytime I download some movies or other things by opening my computer overnight, it must pop out a error window said:-C:\Documents and setting\KkianN\Desktop is not accessible.Not enough quota is available to process this command.The icons only left on my screen were My computer,my network places and Internet explorer. When I refresh my computer, it came out the same message again.(this problem was occured when I opened my computer overnight by using Thunder5 this software to download things)When I tried to shut down, a message said You do not have permission to shut down this computer.When I tried to use windows task manager to shut down,once i click Ctrl+Alt+Del, an application error message came out said:-This application failed to initialize properly(0xc000012d). Click on OK to terminate the application.Then I just can reset my computer.Actually I have posted in BleepingComputer.com > Security > Am I infected? What do I do? there.Then I followed the instruction in "Preparation Guide For Use Before Posting A Hijackthis Log". Unfortunately,i can't finish all the steps there. For step 4, I can't remove win32.generic.pws,win32.trojan.psw.delf and Win32.trojan.pws.onlinegames by using Ad-aware 2007. While scanning by using spybot,it stuck while scanning.After that suddenly pop out a window said:-Spybot-Search and destroy has detected an important registry entry that has been changed. Category: System Startup global entryChange : Value deletedEvtry : ravdh3monold data : C:\Program files\Netmeeting\ravdh3mon.exeMy decision is deny change because I don't know what is it.For step 7, it automatically turns off the Firewall although I manually turn on the Firewall.For your information, when I opened a program,it will automatically close the program that I opened especially website such as www.bleepingcomputer.com. So that I used another computer to post this message.Here the Hijackthis log.(this log I copied from my infected virus computer)Logfile of Trend Micro HijackThis v2.0.2Scan saved at 2:27:56 AM, on 10/14/2007Platform: Windows XP SP2 (WinNT 5.01.2600)MSIE: Internet Explorer v6.00 SP2 (6.00.2900.2180)Boot mode: NormalRunning processes:C:\WINDOWS\System32\smss.exeC:\WINDOWS\system32\csrss.exeC:\WINDOWS\system32\winlogon.exeC:\WINDOWS\system32\services.exeC:\WINDOWS\system32\lsass.exeC:\WINDOWS\system32\svchost.exeC:\WINDOWS\system32\svchost.exeC:\WINDOWS\System32\svchost.exeC:\WINDOWS\system32\svchost.exeC:\WINDOWS\system32\svchost.exeC:\Program Files\Lavasoft\Ad-Aware 2007\aawservice.exeC:\WINDOWS\system32\spoolsv.exeC:\Program Files\Grisoft\AVG Anti-Spyware 7.5\guard.exeC:\WINDOWS\system32\nvsvc32.exeC:\WINDOWS\system32\wdfmgr.exeC:\WINDOWS\System32\alg.exeC:\WINDOWS\system32\wscntfy.exeC:\WINDOWS\RTHDCPL.EXEC:\WINDOWS\system32\RUNDLL32.EXEC:\Program Files\Lavasoft\Ad-Aware 2007\AAWTray.exeC:\Program Files\Grisoft\AVG Anti-Spyware 7.5\avgas.exeC:\WINDOWS\system32\ctfmon.exeC:\Program Files\Common Files\Ahead\Lib\NMBgMonitor.exeC:\Program Files\Common Files\Ahead\Lib\NMIndexStoreSvr.exeC:\Program Files\Common Files\Ahead\Lib\NMIndexingService.exeC:\Program Files\MSN Messenger\usnsvc.exeC:\WINDOWS\system32\conime.exeC:\Program Files\Spybot - Search & Destroy\TeaTimer.exeC:\WINDOWS\explorer.exeC:\Program Files\Spybot - Search & Destroy\SpybotSD.exeC:\Program Files\Trend Micro\HijackThis\HijackThis.exeC:\WINDOWS\system32\wbem\wmiprvse.exeO2 - BHO: Thunder AtOnce - {01443AEC-0FD1-40fd-9C87-E93D1494C233} - C:\Program Files\Thunder Network\Thunder\ComDlls\TDAtOnce_Now.dllO2 - BHO: ThunderBHO - {02478D37-C3F9-4EFB-9B51-7695ECA05670} - C:\Program Files\Thunder Network\Thunder\ComDlls\xunleiBHO_Now.dllO2 - BHO: Yahoo! Companion BHO - {02478D38-C3F9-4efb-9B51-7695ECA05670} - C:\Program Files\Yahoo!\Companion\Installs\cpn\ycomp5_6_0_1.dllO2 - BHO: Skype add-on (mastermind) - {22BF413B-C6D2-4d91-82A9-A0F997BA588C} - C:\Program Files\Skype\Toolbars\Internet Explorer\SkypeIEPlugin.dllO2 - BHO: Spybot-S&D IE Protection - {53707962-6F74-2D53-2644-206D7942484F} - C:\PROGRA~1\SPYBOT~1\SDHelper.dllO2 - BHO: (no name) - {7E853D72-626A-48EC-A868-BA8D5E23E045} - (no file)O2 - BHO: Google Toolbar Helper - {AA58ED58-01DD-4d91-8333-CF10577473F7} - c:\program files\google\googletoolbar2.dllO2 - BHO: (no name) - {C2626E66-D21B-E628-C1DF-1DACCFA36ED2} - C:\Program Files\Common Files\fjOs0r.dllO3 - Toolbar: &Yahoo! Companion - {EF99BD32-C1FB-11D2-892F-0090271D4F88} - C:\Program Files\Yahoo!\Companion\Installs\cpn\ycomp5_6_0_1.dllO3 - Toolbar: &Google - {2318C2B1-4965-11d4-9B18-009027A5CD4F} - c:\program files\google\googletoolbar2.dllO4 - HKLM\..\Run: [IMJPMIG8.1] "C:\WINDOWS\IME\imjp8_1\IMJPMIG.EXE" /Spoil /RemAdvDef /Migration32O4 - HKLM\..\Run: [PHIME2002ASync] C:\WINDOWS\system32\IME\TINTLGNT\TINTSETP.EXE /SYNCO4 - HKLM\..\Run: [PHIME2002A] C:\WINDOWS\system32\IME\TINTLGNT\TINTSETP.EXE /IMENameO4 - HKLM\..\Run: [RTHDCPL] RTHDCPL.EXEO4 - HKLM\..\Run: [Alcmtr] ALCMTR.EXEO4 - HKLM\..\Run: [NeroFilterCheck] C:\Program Files\Common Files\Ahead\Lib\NeroCheck.exeO4 - HKLM\..\Run: [NvCplDaemon] RUNDLL32.EXE C:\WINDOWS\system32\NvCpl.dll,NvStartupO4 - HKLM\..\Run: [nwiz] nwiz.exe /installO4 - HKLM\..\Run: [NvMediaCenter] RUNDLL32.EXE C:\WINDOWS\system32\NvMcTray.dll,NvTaskbarInitO4 - HKLM\..\Run: [AAWTray] C:\Program Files\Lavasoft\Ad-Aware 2007\AAWTray.exeO4 - HKLM\..\Run: [Media Codec Update Service] C:\Program Files\Essentials Codec Pack\update.exe -silentO4 - HKLM\..\Run: [Storm2Set] C:\WINDOWS\system32\rundll32.exe "C:\PROGRA~1\StormII\StormSet.dll",CheckEnvO4 - HKLM\..\Run: [Thunder] "C:\Program Files\Thunder Network\Thunder\Thunder.exe" /sO4 - HKLM\..\Run: [!AVG Anti-Spyware] "C:\Program Files\Grisoft\AVG Anti-Spyware 7.5\avgas.exe" /minimizedO4 - HKLM\..\Run: [MSConfig] C:\WINDOWS\PCHealth\HelpCtr\Binaries\MSConfig.exe /autoO4 - HKLM\..\Run: [ravdh3mon] C:\Program Files\NetMeeting\ravdh3mon.exeO4 - HKLM\..\Run: [KVP] C:\WINDOWS\system32\drivers\svchost.exeO4 - HKCU\..\Run: [CTFMON.EXE] C:\WINDOWS\system32\ctfmon.exeO4 - HKCU\..\Run: [BgMonitor_{79662E04-7C6C-4d9f-84C7-88D8A56B10AA}] "C:\Program Files\Common Files\Ahead\Lib\NMBgMonitor.exe"O4 - HKCU\..\Run: [MsnMsgr] "C:\Program Files\MSN Messenger\MsnMsgr.Exe" /backgroundO4 - HKCU\..\Run: [Skype] "C:\Program Files\Skype\Phone\Skype.exe" /nosplash /minimizedO4 - HKCU\..\Run: [POCO] "C:\Program Files\Poco2007\poco_tools.exe" -p POCOO4 - HKCU\..\Run: [SpybotSD TeaTimer] C:\Program Files\Spybot - Search & Destroy\TeaTimer.exeO4 - HKUS\S-1-5-19\..\Run: [CTFMON.EXE] C:\WINDOWS\system32\CTFMON.EXE (User 'LOCAL SERVICE')O4 - HKUS\S-1-5-20\..\Run: [CTFMON.EXE] C:\WINDOWS\system32\CTFMON.EXE (User 'NETWORK SERVICE')O4 - HKUS\S-1-5-18\..\Run: [CTFMON.EXE] C:\WINDOWS\system32\CTFMON.EXE (User 'SYSTEM')O4 - HKUS\.DEFAULT\..\Run: [CTFMON.EXE] C:\WINDOWS\system32\CTFMON.EXE (User 'Default user')O8 - Extra context menu item: ???????????????? - C:\Program Files\Thunder Network\Thunder\Program\geturl.htmO8 - Extra context menu item: ?????????????????????????????? - C:\Program Files\Thunder Network\Thunder\Program\getallurl.htmO9 - Extra button: ?????????5 - {09BA8F6D-CB54-424B-839C-C2A6C8E6B436} - C:\Program Files\Thunder Network\Thunder\Thunder.exeO9 - Extra 'Tools' menuitem: ?????????5 - {09BA8F6D-CB54-424B-839C-C2A6C8E6B436} - C:\Program Files\Thunder Network\Thunder\Thunder.exeO9 - Extra button: Skype - {77BF5300-1474-4EC7-9980-D32B190E9B07} - C:\Program Files\Skype\Toolbars\Internet Explorer\SkypeIEPlugin.dllO9 - Extra button: (no name) - {DFB852A3-47F8-48C4-A200-58CAB36FD2A2} - C:\PROGRA~1\SPYBOT~1\SDHelper.dllO9 - Extra 'Tools' menuitem: Spybot - Search & Destroy Configuration - {DFB852A3-47F8-48C4-A200-58CAB36FD2A2} - C:\PROGRA~1\SPYBOT~1\SDHelper.dllO9 - Extra button: Messenger - {FB5F1910-F110-11d2-BB9E-00C04F795683} - C:\Program Files\Messenger\msmsgs.exeO9 - Extra 'Tools' menuitem: Windows Messenger - {FB5F1910-F110-11d2-BB9E-00C04F795683} - C:\Program Files\Messenger\msmsgs.exeO10 - Unknown file in Winsock LSP: c:\windows\system32\qdshm.dllO10 - Unknown file in Winsock LSP: c:\windows\system32\qdshm.dllO16 - DPF: {48884C41-EFAC-433D-958A-9FADAC41408E} (EGamesPlugin Class) - https://www.e-games.com.my/com/EGamesPlugin.cabO16 - DPF: {67A5F8DC-1A4B-4D66-9F24-A704AD929EEE} (System Requirements Lab) - http://www.nvidia.com/content/DriverDownlo.../sysreqlab2.cabO16 - DPF: {C3F79A2B-B9B4-4A66-B012-3EE46475B072} (MessengerStatsClient Class) - http://messenger.zone.msn.com/binary/Messe...nt.cab56907.cabO18 - Protocol: skype4com - {FFC8B962-9B40-4DFF-9458-1830C7DD7F5D} - C:\PROGRA~1\COMMON~1\Skype\SKYPE4~1.DLLO20 - AppInit_DLLs: kapjbzy.dllO23 - Service: Ad-Aware 2007 Service (aawservice) - Lavasoft AB - C:\Program Files\Lavasoft\Ad-Aware 2007\aawservice.exeO23 - Service: AVG Anti-Spyware Guard - GRISOFT s.r.o. - C:\Program Files\Grisoft\AVG Anti-Spyware 7.5\guard.exeO23 - Service: Google Updater Service (gusvc) - Google - C:\Program Files\Google\Common\Google Updater\GoogleUpdaterService.exeO23 - Service: NBService - Nero AG - C:\Program Files\Nero\Nero 7\Nero BackItUp\NBService.exeO23 - Service: NMIndexingService - Nero AG - C:\Program Files\Common Files\Ahead\Lib\NMIndexingService.exeO23 - Service: NVIDIA Display Driver Service (NVSvc) - NVIDIA Corporation - C:\WINDOWS\system32\nvsvc32.exe--End of file - 7532 bytesPlease help me to remove it.

Preferred Solution: Infected With Dropper.agent,logger.pcap.a,win32.generic.pws,win32.trojan.psw.delf And Win32.trojan.pws.onlinegames

I recommend downloading and running DAP. It can help sort out any driver and firmware related issues on your system

It's worked out well for many of us in the past.

You can download it direct from this link http://downloaddap.org. (This link will open the download page of DAP so you can save a copy to your computer.)

A: Infected With Dropper.agent,logger.pcap.a,win32.generic.pws,win32.trojan.psw.delf And Win32.trojan.pws.onlinegames

Hello, I had reformatted my computer since it could not open and stuck in the welcome window few days ago. So, now my computer is alright..thanks for viewing and trying to help me to fix the problem.

Read other 1 answers

Hi,Please help me in getting rid of the pop ups which keep coming up.trojan downloader win32 agent bqtrojan clicker win32 tiny htrojan spy win32 key logger.aatrojan spy win32 green screentrojan spy html bankfraud.dqHijakThis log file.Logfile of Trend Micro HijackThis v2.0.2Scan saved at 15:00:40, on 9/8/2008Platform: Windows XP SP2 (WinNT 5.01.2600)MSIE: Internet Explorer v7.00 (7.00.6000.16705)Boot mode: NormalRunning processes:C:\WINDOWS\System32\smss.exeC:\WINDOWS\system32\csrss.exeC:\WINDOWS\system32\winlogon.exeC:\WINDOWS\system32\services.exeC:\WINDOWS\system32\lsass.exeC:\WINDOWS\system32\svchost.exeC:\WINDOWS\system32\svchost.exeC:\WINDOWS\System32\svchost.exeC:\WINDOWS\system32\svchost.exeC:\WINDOWS\system32\svchost.exeC:\Program Files\Common Files\Symantec Shared\ccProxy.exeC:\Program Files\Common Files\Symantec Shared\ccSetMgr.exeC:\Program Files\Symantec Client Security\Symantec Client Firewall\ISSVC.exeC:\Program Files\Common Files\Symantec Shared\SNDSrvc.exeC:\Program Files\Common Files\Symantec Shared\SPBBC\SPBBCSvc.exeC:\Program Files\Common Files\Symantec Shared\ccEvtMgr.exeC:\WINDOWS\system32\spoolsv.exeC:\WINDOWS\Explorer.EXEC:\Program Files\Hewlett-Pac... Read more

A:Infected With Trojan Clicker Win32 Tiny.h / Downloader Win32 Agent Bq / Spy Win32 Key Logger.aa/spy Win32 Green Screen / Html B...

Sorry for the delay. If you are still having problems please post a brand new HijackThis log as a reply to this topic. Before posting the log, please make sure you follow all the steps found in this topic:Preparation Guide For Use Before Posting A Hijackthis LogPlease also post the problems you are having.

Read other 1 answers

KASPERSKY ONLINE SCANNER 7 REPORTSaturday, November 29, 2008Operating System: Microsoft Windows XP Professional Service Pack 3 (build 2600)Kaspersky Online Scanner 7 version: database last update: Friday, November 28, 2008 18:35:48Records in database: 1424124Scan settingsScan using the following database extendedScan archives yesScan mail databases yesScan area My ComputerC:\D:\E:\F:\Scan statisticsFiles scanned 94300Threat name 4Infected objects 4Suspicious objects 0Duration of the scan 02:45:29File name Threat name Threats countC:\Documents and Settings\All Users\Application Data\FreeApp.exe Infected: Trojan.Win32.Agent.arng 1 C:\Qoobox\Quarantine\C\Program Files\tinyproxy\tinyproxy.exe.vir Infected: Trojan-Proxy.Win32.Agent.bcw 1 C:\RECYCLER\S-1-5-21-1482476501-1644491937-682003330-1013\winse32.exe Infected: IRC-Worm.Win32.Small.x 1 C:\WINDOWS\bolivar24.exe Infected: Backdoor.Win32.Agent.ubx 1 The selected area was scanned.----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Logfile of random's system information tool 1.04 (written by random/random... Read more

A:Infected: Trojan.Win32.Agent.arng, Trojan-Proxy.Win32.Agent.bcw, IRC-Worm.Win32.Small.x, Backdoor.Win32.Agent.ubx

Hello and to Bleeping ComputerWe apologize for the delay in responding to your request for help. Here at Bleeping Computer we get overwhelmed at times, and we are trying our best to keep up. Please note that your topic was not intentionally overlooked. Our mission is to help everyone in need, but sometimes it takes just a little longer to get to every request for help.If you have since resolved the original problem you were having, we would appreciate you letting us know. If not please perform the following steps below so we can have a look at the current condition of your machine. If you have not done so, include a description of your problem, along with any steps you may have performed so far.Upon completing the steps below a staff member will review and take the steps necessary with you to get your machine back in working order clean and free of malware.Thanks and again sorry for the delay.We need to see some information about what is happening in your machine. Please perform the following scan:Download DDS by sUBs from one of the following links. Save it to your desktop.DDS.comDDS.scrDDS.pifDouble click on the DDS icon, allow it to run.A small box will open, with an explaination about the tool. No input is needed, the scan is running.Notepad will open with the results, click no to the Optional_ScanFollow the instructions that pop up for posting the results.Close the program window, and delete the program from your desktop.Please note: You may have to disable any scr... Read more

Read other 4 answers

I believe I was infected last night when a website somehow redirected me to liteautogreatest{dot}cn.I'm running XP Home SP3 and the ZoneAlarm Internet Security Suite (just updated earlier today).ZoneAlarm continually finds a couple of problems and hibernates them but they do not go completely away after a reboot.The ZoneAlarm active monitor scan shows the following...Trojan-Dropper.Win32.Agent.amzh was found in C:\Documents and Settings\Don\Local Settings\Temp\BNB.tmp on 4/20/2009 13:29:22Trojan-Dropper.Win32.Agent.amzh was found in C:\Documents and Settings\Don\Local Settings\Temp\BNA.tmp on 4/20/2009 13:23:26Trojan-Dropper.Win32.Agent.amzh was found in C:\Documents and Settings\Don\Local Settings\Temp\BN9.tmp on 4/20/2009 13:17:40Trojan-Dropper.Win32.Agent.amzh was found in C:\Documents and Settings\Don\Local Settings\Temp\BN8.tmp on 4/20/2009 13:14:30Trojan-Dropper.Win32.Agent.amzh was found in C:\Documents and Settings\Don\Local Settings\Temp\BN7.tmp on 4/20/2009 13:07:26Trojan-Dropper.Win32.Agent.amzh was found in C:\Documents and Settings\Don\Local Settings\Temp\BN6.tmp on 4/20/2009 13:02:40Rootkit.Win32.Agent.ikz was found in C:\WINDOWS\system32\drivers\systemntmi.sys on 4/20/2009 12:57:48Trojan-Dropper.Win32.Agent.amzh was found in C:\Documents and Settings\Don\Local Settings\T... Read more

A:Infected with Rootkit.Win32.Agent.ikz, Trojan-Dropper.Win32.Agent.amzh, Trojans? Malware?

Please download ATF Cleaner by Atribune & save it to your desktop. DO NOT use yet.alternate download linkThen download and install SUPERAntiSpyware FreeDouble-click SUPERAntiSypware.exe and use the default settings for installation.An icon will be created on your desktop. Double-click that icon to launch the program.If it will not start, go to Start > All Prgrams > SUPERAntiSpyware and click on Alternate Start.If asked to update the program definitions, click "Yes". If not, update the definitions before scanning by selecting "Check for Updates". (If you encounter any problems while downloading the updates, manually download them from here. Double-click on the hyperlink for Download Installer and save SASDEFINITIONS.EXE to your desktop. Then double-click on SASDEFINITIONS.EXE to install the definitions.)In the Main Menu, click the Preferences... button.Click the "General and Startup" tab, and under Start-up Options, make sure "Start SUPERAntiSpyware when Windows starts" box is unchecked.Click the "Scanning Control" tab, and under Scanner Options, make sure the following are checked (leave all others unchecked):Close browsers before scanning.Scan for tracking cookies.Terminate memory threats before quarantining.Click the "Close" button to leave the control center screen and exit the program.Do not run a scan just yet.Reboot your computer in "Safe Mode" using the F8 method. To do this, re... Read more

Read other 3 answers

m ades, windows xp sp3
to whomever can help- i tried to remove some viruses
using info from bleeping, but am not having any luck.

i downloaded a file that i thought could help me on another
matter, but it had a virus that zone alarm's active scan did not

it was a rootkit virus. i tried tdsskiller several times as well as
malwarebytes, and thought i finally got rid of it. then another
virus popped up despite my not having connected to the internet.

another was this patch virus that kept redirecting my opera
browser. malwarebytes did not see this, but zone alarm did.
i tried to get rid of it and used tdsskiller, and thought i did.
i had to keep switching between safe mode and
normal mode to do it. i had no problems for two weeks, then
both seemed to pop up again. my guess is that i never
actually got rid of them. i tried zone alarm, malwarebytes,
and tdsskiller over and over again, with no luck. then my
ability to connect to the net went away. i gave up and restored
my hdd using the file i made just after i thought i had gotten
rid of the problems, so that though i would still have the viruses,
i would get back the net. using tdsskiller and malwarebytes
still did not work, and a new virus showed up. .

i'm including the logs from zone alarm, malwarebytes, and tdsskiller.

i would really appreciate help.

first to show up. used tdsskiller, seemed to be removed, kept showing back up.

(Forged): C:\WINDOWS\system32... Read more

A:infected with Rootkit.Win32.ZAccess.e, HiddenFile.Multi.Generic, Trojan.Win32.Patched.mf,, Backdoor.Agent.Gen) -> Value: Sh...

ps i have mbam, zone alarm,tdss,
and hijack logs, but was not sure
how to post them since the number
of text characters on this page
was limited.

Read other 70 answers

I have an F-Secure internet security software suite on this computer, and it is up-to-date and functioning. I also have MalwareBytes (free) installed and have been running it regularly, and I use the ESET Online Scanner as well. The OS is Windows XP, and it is up-to-date.About three weeks ago I cleaned around three trojans from this computer using MBAM and the online scanner. A few days ago, Adware.Win32.WebHancer.x was found by F-Secure, and is currently quarantined. Today, several instances of the two Trojan-Spy programs were found and quarantined by F-Secure; they infect system files and system restore files. I already looked up information on cleaning the system restore files by stopping and restarting system restore (and scanning inbetween). I deleted the quarantined files.All of the Spy-Trojan's found are infecting in C:\hp\recovery\wizard\fscommand\. The file names are:AppRecoveryLink_ret.exeCDLogic_ret.exeCreatorLink_ret.exeRestoreLink_ret.exeRTCDLink_ret.exeRunLink_ret.exeSysRecoveryLink_ret.exeWizardLink_ret.exeThe Adware infected a .dll file, and I was advised not to delete it.CDLogic_ret.exe is Agent.bdzz; the rest are Agent.beafI have run my antivirus, MBAM, and the online scanner again and they picked up nothing. Also, the Adware and Trojan-Spy's were all found during MBAM scans, but F-Secure picked them up.I have attached a HiJackThis log and a DDS log; GMER froze my computer partway through the scan when I used it. I have ran a... Read more

A:Infected with Trojan-Spy.Win32.Agent.bdzz, Trojan-Spy.Win32.Agent.beaf, and Adware.Win32.WebHancer.x

Hello and welcome to Bleeping ComputerWe apologize for the delay in responding to your request for help. Here at Bleeping Computer we get overwhelmed at times, and we are trying our best to keep up. Please note that your topic was not intentionally overlooked. Our mission is to help everyone in need, but sometimes it takes just a little longer to get to every request for help. No one is ignored here.If you have since resolved the original problem you were having, we would appreciate you letting us know. If not please perform the following steps below so we can have a look at the current condition of your machine. If you have not done so, include a clear description of the problems you're having, along with any steps you may have performed so far.Upon completing the steps below another staff member will review and take the steps necessary with you to get your machine back in working order clean and free of malware.If you have already posted a DDS log, please do so again, as your situation may have changed.Use the 'Add Reply' and add the new log to this thread.Thanks and again sorry for the delay.We need to see some information about what is happening in your machine. Please perform the following scan:Download DDS by sUBs from one of the following links. Save it to your desktop.DDS.scrDDS.pifDouble click on the DDS icon, allow it to run.A small box will open, with an explaination about the tool. No input is needed, the scan is running.Notepad will open with the results.Foll... Read more

Read other 2 answers


I am on a laptop running Windows 7 and a couple of days ago, Ad-aware found two viruses: Trojan.Win32.Generic!BT & Win32.Trojan.Agent - see details on quarantined items pasted at the bottom of this note. I've tried numerous times to remove the viruses by rebooting, as recommended, and rescanning, but it's only gotten worse. I can now no longer access most of my programs, including any virus scan programs (Adaware, Malwarebytes). I was able to download RKill but when I try to run any of the different versions nothing happens - have tried renaming with no sucess. When using Internet Explorer, Google search is redirected to other sites. I've tried using safe mode with the same results.

Please let me know if you can help? Here's the virus scan log from a few days ago, when I was actually able to run Adaware.

Thanks in advance!!

Scan Log:

Quarantined items:
Description: c:\programdata\f4d55f3b0001577a000a86a2b4eb2367\f4d55f3b0001577a000a86a2b4eb2367.exe Family Name: Trojan.Win32.Generic!BT Engine: 3 Clean status: Success Item ID: 1 Family ID: 0 MD5: 7f544794965c873108012225055eafd6
Description: c:\windows\assembly\gac_32\desktop.ini Family Name: Trojan.Win32.Generic!BT Engine: 3 Clean status: Reboot required Item ID: 1 Family ID: 0 MD5: 878F9B6DA85CB98FCBDF6ABD1730A32F
Description: c:\windows\assembly\temp\u\[email protected] Family Name: Trojan.Win32.Generic!BT Engine... Read more

A:Infected with Trojan.Win32.Generic!BT & Win32.Trojan.Agent

Hello, let see if we can do these.If RKill still fails ,move on.Please click Start > Run, type inetcpl.cpl in the runbox and press enter.Click the Connections tab and click the LAN settings option.Verify if "Use a proxy..." is checked, if so, UNcheck it and click OK/OK to exit.Please download MiniToolBox, save it to your desktop and run it. Checkmark the following checkboxes: Flush DNS Report IE Proxy Settings Reset IE Proxy Settings Report FF Proxy Settings Reset FF Proxy Settings List content of Hosts List IP configuration List Winsock Entries List last 10 Event Viewer log List Installed Programs List Devices List Users, Partitions and Memory size. List Minidump FilesClick Go and post the result (Result.txt). A copy of Result.txt will be saved in the same directory the tool is run. Note: When using "Reset FF Proxy Settings" option Firefox should be closed.Reboot into Safe Mode with Networking How to enter safe mode(XP/Vista)Using the F8 MethodRestart your computer. When the machine first starts again it will generally list some equipment that is installed in your machine, amount of memory, hard drives installed etc. At this point you should gently tap the F8 key repeatedly until you are presented with a Windows XP Advanced Options menu. Select the option for Safe Mode with Networking using the arrow keys. Then press enter on your keyboard to boot into Safe Mode. >>>> Download this file and doubleclick on it to run it. Allow the informat... Read more

Read other 15 answers

Just yesterday I appear to have found contracted a virus. No matter what method I use to remove it, everytime I restart my computer, it is back. Hopefully someone will be able to help me. Per Ad-Ware, this is what was found:
Trojan.Win32.Generic!BT - c:\windows\system32\d-link_st3402.dll
Win32.Trojan.Agent - c:\windows\system32\d-link_st3402.dll

I ran the MiniToolBox and have attached the results of that. I tried running going into safe mode and running RKill, then SAS, then rebooting into normal mode and running MBAN but it always seems to come back. I also attached the MBAN log as well.

I hope someone can help, otherwise it looks like a long night of reformatting is ahead of me......

A:Infected with Trojan.Win32.Generic!BT & Win32.Trojan.Agent

Since we're dealing here with ZeroAccess rootkit....Please follow the instructions in ==>This Guide<== starting at Step 6. If you cannot complete a step, skip it and continue.Once the proper logs are created, then make a NEW TOPIC and post it ==>HERE<== Please include a description of your computer issues, what you have done to resolve them, and a link to this topic.If you can produce at least some of the logs, then please create the new topic and explain what happens when you try to create the log(s) that you couldn't get. If you cannot produce any of the logs, then still post the topic and explain that you followed the Prep. Guide, were unable to create the logs, and describe what happens when you try to create the logs.It would be helpful if you post a note here once you have completed the steps in the guide and have started your topic in malware removal. Good luck and be patient.If HelpBot replies to your topic, PLEASE follow Step One so it will report your topic to the team members.

Read other 1 answers

system spec

intel 6320
2gig ram
unkown MB

recently i noticed my pc getting a lot slower than normal IE scrolling down on an email would cause the window to stutter where normaly it would be smooth. i ran a virus scan useing AVG (paid version) and it didnt come up with anything i also ran adaware and i tried to install spybot but it unable to connect to the server to install. i tried the same spybot exe on a seperate machine and it installed fine

the computer was still slow so i ran a kaspersky online scan which found a few trojans and backdoors (see attached txt) that AVG fails to detect.


DDS (Ver_10-03-17.01) - NTFSx86
Run by L.HALL at 20:30:22.25 on 24/08/2010
Internet Explorer: 7.0.5730.13
Microsoft Windows XP Professional 5.1.2600.3.1252.1.1033.18.2046.1443 [GMT 1:00]

AV: AVG Internet Security *On-access scanning enabled* (Updated) {17DDD097-36FF-435F-9E1B-52D74245D6BF}
FW: AVG Firewall *enabled* {8decf618-9569-4340-b34a-d78d28969b66}

============== Running Processes ===============

C:\WINDOWS\system32\svchost -k DcomLaunch
C:\WINDOWS\System32\svchost.exe -k netsvcs
C:\Program Files\AVG\AVG9\avgchsvx.exe
C:\Program Files\AVG\AVG9\avgrsx.exe
C:\Program Files\AVG\AVG9\avgcsrvx.exe
C:\Program Files\Common Files\Apple\Mobile Device Support\bin\AppleMobileDeviceSer... Read more

A:Trojan.Win32.Agent.dkai, Backdoor.Win32.Delf.nut plus others

Hello and Welcome to TSF.

Please Subscribe to this Thread to get immediate notification of replies as soon as they are posted. To do this click Thread Tools, then click Subscribe to this Thread. Make sure it is set to Instant notification by email, then click Add Subscription.

Please note that the forum is very busy and if I don't hear from you within three days this thread will be closed.


Please note that these fixes are not instantaneous. Most infections require more than one round to properly eradicate.

Please stay with me until given the 'all clear' even if symptoms seemingly abate.

Kindly follow my instructions and please do no fixing on your own or running of scanners unless requested by a helper.


Please visit this webpage for download links, and instructions for running ComboFix:


* Ensure you have disabled all antivirus and antimalware programs so they do not interfere with the running of ComboFix.

Get help here

Please post the C:\ComboFix.txt in your next reply for further review.

Please re-enable your antivirus before posting the ComboFix.txt log.


Read other 13 answers

I have been clearing a computer from numerous infections. I uninstalled the outdated (since 2006) McAfee AV. I have installed Microsoft Security Essentials, MBAM, and SuperAntiSpyware. I used this combination as well as several online scanners to remove over 150 infections. Every time I run a scan with SAS, the log comes back with the following infections:Trojan.Dropper/SVCHost-FakeC:\SYSTEM VOLUME INFORMATION\_RESTORE{D5FFFA500B1B}\SVCHOST.EXEC:\SYSTEM VOLUME INFORMATION\_RESTORE{D5FFFA500B1B}\SVCHOST.EXETrojan.Agent/Gen-FakeAlertC:\SYSTEM VOLUME INFORMATION\_RESTORE{D5FFFA500B1B}\SMSS.EXEC:\SYSTEM VOLUME INFORMATION\_RESTORE{D5FFFA500B1B}\SMSS.EXEMicrosoft Security Essentials pops up during the scan with the following infection:Trojan Downloader: Win32/Unruy.D C:\SYSTEM VOLUME INFORMATION\_RESTORE{D5FFFA500B1B}\SMSS.EXE I created a new restore point and deleted all previous points, yet these infections still remain. I was receiving help from another moderator who had me try several things before directing me here. Topic referenced is here: http://www.bleepingcomputer.com/forums/t/318510/cannot-remove-trojan/ ~ OB I am posting the DDS log, GMER log, and attaching the attach.txt file. Thank you in advance for any and all help you can provide. DDS (Ver_10-03-17.01) - NTFSx86 Run by Phillips at 14:21:21.10 on Tue 05/25/2010Internet Explorer: 8.0.6001.18702Microsoft Windows XP Home Edition 5.1.2600.3.1252.1.1033.18.1278.796 [GMT -4:00]AV: Microsoft Security Essentials *... Read more

A:Infected with: Trojan.Dropper/SVCHost-Fake,Trojan.Agent/Gen-FakeAlert, & Trojan Downloader: Win32/Unruy.D.

Hello and welcome to Bleeping ComputerWe apologize for the delay in responding to your request for help. Here at Bleeping Computer we get overwhelmed at times, and we are trying our best to keep up. Please note that your topic was not intentionally overlooked. Our mission is to help everyone in need, but sometimes it takes just a little longer to get to every request for help. No one is ignored here.If you have since resolved the original problem you were having, we would appreciate you letting us know. If not please perform the following steps below so we can have a look at the current condition of your machine. If you have not done so, include a clear description of the problems you're having, along with any steps you may have performed so far.Upon completing the steps below another staff member will review and take the steps necessary with you to get your machine back in working order clean and free of malware.If you have already posted a DDS log, please do so again, as your situation may have changed.Use the 'Add Reply' and add the new log to this thread.Thanks and again sorry for the delay.We need to see some information about what is happening in your machine. Please perform the following scan:Download DDS by sUBs from one of the following links. Save it to your desktop.DDS.scrDDS.pifDouble click on the DDS icon, allow it to run.A small box will open, with an explaination about the tool. No input is needed, the scan is running.Notepad will open with the results.Foll... Read more

Read other 19 answers

After start the laptop, (hidden) host.exe is consuming a lot of resources until crash. I can see and kill it with procesexplorer from Sysinternals.
I can't activate Windows Firewall, Malwarebytes show an error at coomputer start up and more...

When I start GMER it shows an error, it is attached.

Here the logs of DDS and GMER:
DDS (Ver_2011-08-26.01) - NTFSx86
Internet Explorer: 8.0.7601.17514 BrowserJavaVersion: 1.6.0_23
Run by sebastian at 16:41:18 on 2012-03-19
Microsoft Windows 7 Enterprise 6.1.7601.1.1252.54.1033.18.2925.1107 [GMT -3:00]
SP: Windows Defender *Disabled/Updated* {D68DDC3A-831F-4fae-9E44-DA132C1ACF46}
============== Running Processes ===============
C:\Windows\system32\svchost.exe -k DcomLaunch
C:\Windows\system32\svchost.exe -k RPCSS
C:\Windows\System32\svchost.exe -k LocalServiceNetworkRestricted
C:\Windows\System32\svchost.exe -k LocalSystemNetworkRestricted
C:\Windows\system32\svchost.exe -k netsvcs
C:\Windows\system32\svchost.exe -k LocalService
C:\Program Files\NVIDIA Corporation\Display\NvXDSync.exe
C:\Windows\system32\svchost.exe -k NetworkService
C:\Program Files\ASUS\ATK Package\ATK Hotkey\ASLDRSrv.ex... Read more

A:trojan-Dropper.win32.injector.ciwr | trojan.win32.agent2.faav | Virus.Win32.ZAccess.q

Hello sebamobile, Welcome to Bleeping Computer.
My name is fireman4it and I will be helping you with your Malware problem.

Please take note of some guidelines for this fix:
Refrain from making any changes to your computer including installing/uninstall programs, deleting files, modifying the registry, and running scanners or tools.
If you do not understand any step(s) provided, please do not hesitate to ask before continuing.
Even if things appear to be better, it might not mean we are finished. Please continue to follow my instructions and reply back until I give you the "all clean".
In the upper right hand corner of the topic you will see a button called Watch Topic.I suggest you click it and select Immediate E-Mail notification and click on Proceed. This way you will be advised when we respond to your topic and facilitate the cleaning of your machine.

Finally, please reply using the ADD REPLY button in the lower right hand corner of your screen. Do not start a new topic. The logs that you post should be pasted directly into the reply, unless they do not fit into the post.
I will be analyzing your log. I will get back to you with instructions.

Read other 14 answers

I believe that I have been infected by the following Virus: Rootkit.Agent/Gen-DNSHack; WIN32.Downloader.Small.afwj; Win32.Trojan.Dropper.VB.TR. They were all removed by either Zone Alarm Anti-Spyware and SuperAntiSpyware. However, I continue to have the symptoms: sporadic hijack of my keyboard so keystrokes are exected in what appears to be a random fashion. I say it's random because most of the time what's typed by the virus doesn't make any sese.I was working with FAX in the ZoneAlarm user forum who recomended the malware removal tools and suggested I post my Hijackthis log if all else failed. All else has failed. Following is the log. Thanks for your help.
 hijackthis.log   16.26KB
  17 downloadsLogfile of Trend Micro HijackThis v2.0.2Scan saved at 1:13:46 PM, on 6/28/2009Platform: Windows Vista SP2 (WinNT 6.00.1906)MSIE: Internet Explorer v8.00 (8.00.6001.18702)Boot mode: NormalRunning processes:C:\Program Files (x86)\Siber Systems\AI RoboForm\robotaskbaricon.exeC:\Program Files (x86)\WinZip\WZQKPICK.EXEC:\Program Files (x86)\WordWeb\wweb32.exeC:\Program Files (x86)\Hewlett-Packard\Media\DVD\DVDAgent.exeC:\Program Files (x86)\Hewlett-Packard\TouchSmart\Media\TSMAgent.exeC:\Program Files (x86)\Hewlett-Packard\TouchSmart\Media\Kernel\CLML\CLMLSvc.exeC:\Program Files (x86)\HPQ\HP Connection Manager 2�... Read more

A:Infection by Rootkit.Agent/Gen-DNSHack; WIN32.Downloader.Small.afwj; Win32.Trojan.Dropper.VB.TR

Hello and welcome to Bleeping ComputerWe apologize for the delay in responding to your request for help. Here at Bleeping Computer we get overwhelmed at times, and we are trying our best to keep up. Please note that your topic was not intentionally overlooked. Our mission is to help everyone in need, but sometimes it takes just a little longer to get to every request for help. No one is ignored here.If you have since resolved the original problem you were having, we would appreciate you letting us know. If not please perform the following steps below so we can have a look at the current condition of your machine. If you have not done so, include a clear description of the problems you're having, along with any steps you may have performed so far.Upon completing the steps below another staff member will review and take the steps necessary with you to get your machine back in working order clean and free of malware.If you have already posted a DDS log, please do so again, as your situation may have changed.Use the 'Add Reply' and add the new log to this thread.Thanks and again sorry for the delay.We need to see some information about what is happening in your machine. Please perform the following scan:We need to create an OTL ReportPlease download OTL from one of the following mirrors:This is THE MirrorSave it to your desktop.Double click on the icon on your desktop.Click the "Scan All Users" checkbox.Push the button.Two reports will open, copy and paste them in a... Read more

Read other 26 answers

Hi,It seems that I have trojan activity on my home pc.I am running Vista and when I log in to my user profile I get a blue desktop with a box saying 'Warning! Spyware detected on your computer! Install an antivirus or spyware remover to clean your computer'I have tried a few malware removal programs, Malwarebytes, CCleaner, Adaware and ran virus scans in an attemp to try and remove it myself without bothering you guys but I just can't shift it, so I'm hoping you may have the time to help?What I have noticed is that I only get these warnings when I am logged into my user profile, not as administrator or as another user on the pc. I also get no warnings when running in safe mode.I run Avast and that brings up a warning soon after the blue desktop comes up that points to infection with C:\Users\Guy\AppsData\Local\Temp\tt991.tmp.vbs. The numbers/letters after the tt (in this case 991) change each time I log in. It also states Malware Name: VBS:Malware-gen, Malware Type: Virus/Worm, VBS verison 080805-0,08/05/08 which I try and delete from the warning box.I then am greeted with a windows script host message box that will say the above file (tt991.tmp.vbs) failed (Access Denied).I also regularly get Windows security alert message boxes come up on the screen saying that Windows Firewall has detected activity of harmfull software with mention of one of many trojans. These have been:Trojan-Clicker.Win32.Tiny.hTrojan-Downloader.Win32.Agent.bqTrojan... Read more

A:Vbs:malware-gen - Trojan-clicker.win32.tiny.h, Trojan-downloader.win32.agent.bq, Trojan-spy.win32.keylogger.aa

Hi,I am hoping you can help me.My computer keeps telling me it is infected with spyware/malware. I get a blue desktop on startup with regular warnings saying the computer is infected with:Trojan-Clicker.Win32.Tiny.hTrojan-Downloader.Win32.Agent.bqTrojan-Spy.Win32.KeyLogger.aaTrojan-Spy.Win32.GreenScreenTrojan-Spy.HTML.Bankfraud.dqStrange thing is that these only show up when I log in to my user account. If I log in as administrator, another user or as any user in safe mode I get no warnings and nothing shows up on scans.The pop up warings direct me to this site: www.antispyware-review.info/?wmid=46638&pwebmid=uWfLn0pimL&a= which is Smartsoft reviews to buy PC Antispy or PC Clean pro.Malwarebytes scan picks up Fake.Dropped.Malware, Malware.Trace, Trojan.FakeAlert and Hijack.Wallpaper and even if I remove these and restart the PC they come back.A spybot scan pointed to 2 entries of VirtumondeI'll attach the latest HJT log, Malwarebytes log and Spybot logs in case you need them. Please help me with this, I cant seem to shift it Logfile of Trend Micro HijackThis v2.0.2Scan saved at 11:54:34 AM, on 8/7/2008Platform: Windows Vista SP1 (WinNT 6.00.1905)MSIE: Internet Explorer v7.00 (7.00.6001.18000)Boot mode: NormalRunning processes:C:\Windows\system32\taskeng.exeC:\Windows\system32\Dwm.exeC:\Windows\Explorer.EXEC:\Program Files\Windows Defender\MSASCui.exeC:\Windows\RtHDVCpl.exeC:\Program Files\Ado... Read more

Read other 5 answers

hi , kaspersky scan(included at the end ) came up with a few infections, please help me with removal logs:Logfile of random's system information tool 1.04 (written by random/random)Run by Yanai Michael at 2008-12-14 13:16:05Microsoft Windows XP Home Edition Service Pack 3System drive C: has 4 GB (9%) free of 53 GBTotal RAM: 1526 MB (53% free)Logfile of Trend Micro HijackThis v2.0.2Scan saved at 13:16:16, on 14/12/2008Platform: Windows XP SP3 (WinNT 5.01.2600)MSIE: Internet Explorer v7.00 (7.00.6000.16762)Boot mode: NormalRunning processes:C:\WINDOWS\System32\smss.exeC:\WINDOWS\system32\winlogon.exeC:\WINDOWS\system32\services.exeC:\WINDOWS\system32\lsass.exeC:\WINDOWS\System32\ibmpmsvc.exeC:\WINDOWS\system32\svchost.exeC:\WINDOWS\System32\svchost.exeC:\Program Files\Intel\Wireless\Bin\EvtEng.exeC:\Program Files\Intel\Wireless\Bin\S24EvMon.exeC:\WINDOWS\system32\spoolsv.exeC:\Program Files\Bonjour\mDNSResponder.exeC:\Program Files\CheckPoint\SSL Network Extender\slimsvc.exeC:\Program Files\Google\Common\Google Updater\GoogleUpdaterService.exeC:\Program Files\IBM\IBM Rapid Restore Ultra\rrpcsb.exeC:\Program Files\Common Files\Microsoft Shared\VS7Debug\mdm.exeC:\Program Files\Microsoft LifeCam\... Read more

A:got Trojan.Win32.Agent.asvc Trojan-GameThief.Win32.Magania.amrr Worm.Win32.AutoRun.trh

Welcome to the BleepingComputer Forums. Since it has been a few days since you scanned your computer with HijackThis, we will need a new HijackThis log. If you have not already downloaded Random's System Information Tool (RSIT), please download Random's System Information Tool (RSIT) by random/random which includes a HijackThis log and save it to your desktop. If you have RSIT already on your computer, please run it again. Double click on RSIT.exe to run RSIT. Click Continue at the disclaimer screen. After it has finished, two logs will open. Please post the contents of both. log.txt will be maximized and info.txt will be minimized. Thank you for your patience.Please see Preparation Guide for use before posting about your potential Malware problem. Thank you for your patience.If you have already posted this log at another forum or if you decide to seek help at another forum, please let us know. There is a shortage of helpers and taking the time of two volunteer helpers means that someone else may not be helped. While we are working on your HijackThis log, please: Reply to this thread; do not start another! Do not make any changes on your computer during the cleaning process or download/add programs on your computer unless instructed to do so. Do not run any other tool until instructed to do so! Let me know if any of the links do not work or if any of the tools do not work. Tell me about problems or symptoms that occur during the fix. Do... Read more

Read other 7 answers

Hello, I was told to post here by the moderator. Here's the scoop: I was infected with a virus and didn't have any protection on my PC. I went out and bought Kaspersky Internet Security 2009. My original problem was that the virus was not allowing me to surf the internet with out popups and redirects. After running the Kaspersky software it cleaned up a bunch of issues but has gotten to a point were it cannot clean the last two issues. It recognizes them and marks them for deletion but asks me to reboot in order to delete. After I reboot it just finds the viruses again and I repeat the process endlessly.

I went through some troubleshooting steps with a Kaspersky rep and she decided that she had exhausted all options and asked me to format the computer. That is not an option and I don't believe that there is no hope of cleaning the virus. I am in need of someone with a little more expertise and vigilance.

The two issues are described below as listed by the Kaspersky software:
1. Trojan-Cliker.win32.delf.cbe - Object: C:\windows\system32\gznvqkei.dll
2. Rootkit.win32.Podnuha.a - Object: System Memory

When I try to manually delete the gznvqkei.dll file I get an "Access Denied" error.

The Kaspersky rep did have me run the combofix software but it did not solve the issue. She had me run a custom script from within the AV software that was designed to delete the troubled files to no avail. She also had me create a boot disk but when using the boot d... Read more

A:2 Infected - Rootkit.win32.Podnuha.a and Trojan-Cliker.win32.delf.cbe

Hello dmacc01.If you still have the same issues, you may consider the following. But first, be absolutely aware that having the system without an antivirus program is an extremely dangerous thing.Let's have you create a restore point (at this time). 1. Right click the My Computer icon on the Desktop and click on Properties.2. Click on the System Restore tab.3. If there is a check mark next to "Turn off System Restore on all drives", then click on the line to clear it.4. If C is your system drive (as it is in most cases) and you see other drives monitored in the list (like D, E, etc) click on the other drives, press Settings button, and get the other drives turned off.5. we only want to monitor the drive with Windows o.s.If you are unable to activate System Restore or if the service is disabled, then.....from the Start button > RUN option .... type in services.msclook for System Restore serviceIf it is listed as off or inactive, press on the link at top left to Start it.Next, See and do as outlined here http://bertk.mvps.org/html/createrp.htmlAfter that, also do this:1. Go >> Here << and download ERUNT (ERUNT (Emergency Recovery Utility NT) is a free program that allows you to keep a complete backup of your registry and restore it when needed.)2. Install ERUNT by following the prompts (use the default install settings but say no to the portion that asks you to add ERUNT to the start-up folder, if you like you can enable this option later)3. Start ERUNT... Read more

Read other 4 answers

Hello, I was infected with a virus and didn't have any protection on my PC. I went out and bought Kaspersky Internet Security 2009. My original problem was that the virus was not allowing me to surf the internet with out popups and redirects. After running the Kaspersky software it cleaned up a bunch of issues but has gotten to a point were it cannot clean the last two issues. It recognizes them and marks them for deletion but asks me to reboot in order to delete. After I reboot it just finds the viruses again and I repeat the process endlessly.

I went through some troubleshooting steps with a Kaspersky rep and she decided that she had exhausted all options and asked me to format the computer. That is not an option and I don't believe that there is no hope of cleaning the virus. I am in need of someone with a little more expertise and vigilance.

The two issues are described below as listed by the Kaspersky software:
1. Trojan-Cliker.win32.delf.cbe - Object: C:\windows\system32\gznvqkei.dll
2. Rootkit.win32.Podnuha.a - Object: System Memory

When I try to manually delete the gznvqkei.dll file I get an "Access Denied" error.

The Kaspersky rep did have me run the combofix software but it did not solve the issue. She had me run a custom script from within the AV software that was designed to delete the troubled files to no avail. She also had me create a boot disk but when using the boot disk it does not recognize my hard drive so ... Read more

A:2 Infected - Rootkit.win32.Podnuha.a and Trojan-Cliker.win32.delf.cbe

Probably you best chance is to submit a HJT logPlease read the pinned topic titled "Preparation Guide For Use Before Posting A Hijackthis Log". If you cannot complete a step, then skip it and continue with the next. In Step 6 there are instructions for downloading and running DDS which will create a Pseudo HJT Report as part of its log.When you have done that, post your log in the HijackThis Logs and Malware Removal forum, NOT here, for assistance by the HJT Team Experts. A member of the Team will walk you through, step by step, on how to clean your computer. If you post your log back in this thread, the response from the HJT Team will be delayed because your post will have to be moved. This means it will fall in line behind any others posted that same day. Start a new topic, give it a relevant title and post your log along with a brief description of your problem, a summary of any anti-malware tools you have used and a summary of any steps that you have performed on your own. An expert will analyze your log and reply with instructions advising you what to fix. After doing this, we would appreciate if you post a link to your log back here so we know that your getting help from the HJT Team.Please be patient. It may take a while to get a response because the HJT Team members are very busy working logs posted before yours. They are volunteers who will help you out as soon as possible. Once you have made your post and are waiting, please DO NOT "bump" your post or make another r... Read more

Read other 3 answers

old sony laptop with windows xp pro sp3 intel pentium 3 with 640 MB rami've got some nasty bugs on my laptop. i can remove them with spybot or malwarebytes, but they come back every time i restart the pc. they are able to turn off windows firewall and symantec anti-virus autoprotect. my laptop got infected after my desktop, so both are only in safemode and off the network for now. any help would be greatly appreciated.from spybot:win32.delf.ucfrom malwarebytes:HKEY_LOCAL_MACHINE\SOFTWARE\Microsoft\Windows NT\CurrentVersion\Windows\llpinit_dlls (Spyware.Agent.H) -> Quarantined and deleted successfully.C:\WINDOWS\system32\nvtpm32.dll (Spyware.Agent.H) -> Delete on reboot.C:\WINDOWS\system32\D.tmp (Trojan.Agent) -> Quarantined and deleted successfully.C:\WINDOWS\system32\E.tmp (Trojan.Agent) -> Quarantined and deleted successfully.C:\WINDOWS\system32\F.tmp (Trojan.Agent) -> Quarantined and deleted successfully.C:\WINDOWS\system32\azton.mt (Trojan.Agent) -> Quarantined and deleted successfully.Here is my log from HijackThis:Logfile of Trend Micro HijackThis v2.0.2Scan saved at 7:41:32 AM, on 3/2/2009Platform: Windows XP SP3 (WinNT 5.01.2600)MSIE: Internet Explorer v7.00 (7.00.6000.16791)Boot mode: NormalRunning processes:C:\WINDOWS\System32\smss.exeC:\WINDOWS\system32\winlogon.exeC:\WINDOWS\system32\services.ex... Read more

A:Laptop infected with win32.delf.uc, Spyware.Agent.H, and Trojan.Agent

you can close this out as i actually just did a clean reinstall of the OS. however, if anyone can help me with my other PC i'd prefer to not reinstall it as well:http://www.bleepingcomputer.com/forums/t/207842/desktop-infected-with-trojanagent-more/it has:trojan.agentadware.cometadware.starwaretrojan.dnschangerthanks!

Read other 2 answers

HelloMy son has managed to get Trojan(s) on his laptop... Windows XP Pro SP2I deleted temporary files, cleared cookies, turned off system restore and ran Norton, A-Squared free, SpyBot 1.6 and Ad-aware SE Personal 2008Norton claims to have dealt with trojan.zlob and A-Squared found and cleared the trojan-dropperIs there anything else I need to worry about please? If so please can you help me to remove it? I have reached my level of understanding and am not technical enough to understand the Hijackthis log.Many thanksLin=================The Hijackthis log follows:Logfile of Trend Micro HijackThis v2.0.2Scan saved at 14:52:45, on 15/08/2008Platform: Windows XP SP2 (WinNT 5.01.2600)MSIE: Internet Explorer v7.00 (7.00.6000.16705)Boot mode: NormalRunning processes:C:\WINDOWS\System32\smss.exeC:\WINDOWS\system32\winlogon.exeC:\WINDOWS\system32\services.exeC:\WINDOWS\system32\lsass.exeC:\WINDOWS\system32\svchost.exeC:\WINDOWS\System32\svchost.exeC:\Program Files\Intel\Wireless\Bin\EvtEng.exeC:\Program Files\Intel\Wireless\Bin\S24EvMon.exeC:\Program Files\Common Files\Symantec Shared\ccSetMgr.exeC:\Program Files\Common Files\Symantec Shared\ccEvtMgr.exeC:\Program Files\Common Files\Symantec Shared\ccProxy.exeC:\Program Files\Common Files\Symantec Shared\PIF\{B8E1... Read more

A:Infected With Trojan.zlob - Trojan-dropper.win32.agent.rvv

Hi elsiegee40Please make sure you have system restore turned on again ... actually you should NOT have turned it off, you now have NO restore points to fall back upon. despite what Norton & others may say, you should not turn restore off (purge system restore) until your computer is clean ... even an infected restore point is better than none at all.Your hijackthis log is clean, but that doesn't mean your computer is, from experience I doubt Norton has removed all the malware ...Download Deckard's System Scanner (formerly Comboscan) to your Desktop.Note: You must be logged onto an account with administrator privileges.1. Close all applications and windows. 2. Double-click on dss.exe to run it, and follow the prompts. 3. When the scan is complete, two text files will open - main.txt <- this one will be maximized and extra.txt <-this one will be minimized 4. Copy (Ctrl+A then Ctrl+C) and paste (Ctrl+V) the contents of main.txt in your next reply.5. Then do the same with extra.txtNote: you'll find extra.txt here :- C:\Deckard\System Scanner\extra.txtPlease remember to post both txt files ...Note: some firewalls may warn that sigcheck.exe is trying to access the internet - please ensure that you allow sigcheck.exe permission to do so.THEN ..Please Download Malwarebytes' Anti-Malware from Here :-http://www.majorgeeks.com/Malwarebytes_Ant...ware_d5756.htmlor here :-http://www.besttechie.net/tools/mbam-setup.exeDouble Click mbam-setup.exe to install the appl... Read more

Read other 6 answers

Hi I have been overrun with adware etc in the last month or so. Have run through the steps in your preperation guide. Any help much appreciated.Thanks DaveLogfile of HijackThis v1.99.1Scan saved at 12:59:22, on 16/01/2006Platform: Windows XP SP2 (WinNT 5.01.2600)MSIE: Internet Explorer v6.00 SP2 (6.00.2900.2180)Running processes:C:\WINDOWS\System32\smss.exeC:\WINDOWS\system32\winlogon.exeC:\WINDOWS\system32\services.exeC:\WINDOWS\system32\lsass.exeC:\WINDOWS\system32\svchost.exeC:\WINDOWS\System32\svchost.exeC:\WINDOWS\system32\spoolsv.exeC:\WINDOWS\Explorer.EXEC:\WINDOWS\system32\RUNDLL32.EXEC:\Program Files\Dell\AccessDirect\dadapp.exeC:\Program Files\Apoint\Apoint.exeC:\WINDOWS\System32\DSentry.exeC:\WINDOWS\system32\pctspk.exeC:\Program Files\Hewlett-Packard\HP Share-to-Web\hpgs2wnd.exeC:\Program Files\SMSC\Seticon.exeC:\Program Files\Common Files\Real\Update_OB\realsched.exeC:\Program Files\QuickTime\qttask.exeC:\Program Files\Roxio\Easy Media Creator 7\Drag to Disc\DrgToDsc.exeC:\Program Files\CA\eTrust EZ Armor\eTrust EZ Antivirus\CAVTray.exeC:\Program Files\CA\eTrust EZ Armor\eTrust EZ Antivirus\CAVRID.exeC:\Program Files�... Read more

A:Infected With Win32.delf.trojan.b And Win32.centim

Please print out or copy this page to Notepad. Make sure to work through the fixes in the exact order in which they are mentioned below. If there's anything that you don't understand, ask your question(s) before proceeding with the fixes.Step #1Please click: Start--> Control Panel--> Add or Remove Programs--> Uninstall (if found) any instances of:Daily Weather ForecastThen reboot your computer.Step #2Scan again with HijackThis and check the following items:O2 - BHO: metaspinner GmbH - {7C7A8947-5935-4430-AC0E-E7D04697414E} - C:\PROGRA~1\BUYERT~1\IEBUTT~2.DLL (file missing)O2 - BHO: metaspinner GmbH - {CD9B7762-DFBC-42B1-BB30-02A78287B456} - C:\PROGRA~1\BUYERT~1\IEBUTT~1.DLL (file missing)O2 - BHO: (no name) - {E3215F20-3212-11D6-9F8B-00D0B743919D} - (no file)O4 - HKLM\..\Run: [Daily Weather Forecast] C:\Program Files\Daily Weather Forecast\weather.exeAfter checking these items, close all browser windows except HijackThis and click "Fix checked".Step #3We need to make sure all hidden files are showing so please:Click Start.Open My Computer.Select the Tools menu and click Folder Options.Select the View tab.Under the Hidden files and folders heading select Show hidden files and folders.Uncheck the Hide file extensions for known types option.Uncheck the Hide protected operating system files (recommended) option.Click Yes to confirm.Click OK.Step #4Reboot Your System in Safe Mode:Restart the computer.As s... Read more

Read other 9 answers

It attacked IE first. I used Ad-Aware and CCleaner. It seemed to go away. Then it came back and attacked Firefox. I used Malwarebytes' Anti-Malware in conjunction with Ccleaner and it wouldn't go away. After every use, there would still be another DLL file to find and destroy, even if Malwarebytes' Anti-Malware said it was successful. Often the files that returned were different DLLs then before.I have no Window's Explorer due to this infection. Managed to run tasks anyway and found you guys on google when I entered in a DLL file name that I had originally found while scanning. I can't recall the name of the offending DLL... Ran the Kaspersky Scanner, and the Highjack This Scanner. All results are posted below. KASPERSKY ONLINE SCANNER 7 REPORTSaturday, December 6, 2008Operating System: Microsoft Windows XP Professional Service Pack 2 (build 2600)Kaspersky Online Scanner 7 version: database last update: Saturday, December 06, 2008 03:47:06Records in database: 1439820Scan settingsScan using the following database extendedScan archives yesScan mail databases yesScan area Critical AreasC:\Documents and Settings\All Users\Start Menu\Programs\StartupC:\Documents and Settings\Kienzle\Start Menu\Programs\StartupC:\Program FilesC:\WINDOWSScan statisticsFiles scanned 112172Threat name 2Infected objects 2Suspicious objects 0Duration of the scan 01:05:54File name Threat name Threats countC:\WINDO... Read more

A:Infected; Trojan.Win32.Agent.asjk, Trojan.Win32.Monder.aane

Hello! My name is Sam and I will be helping you. In order to see what's going on with your computer I may ask for you to post various logs from the tools that we will use to resolve your issue. Please also share with me any information about how your computer is reacting and behaving each step of the way as we work through this process.Please download ComboFix from one of these locations:Link 1Link 2Link 3Important!You should NOT use Combofix unless you have been instructed to do so by a Malware Removal Expert. It is intended by its creator to be used under the guidance and supervision of an Malware Removal Expert, not for private use.Using this tool incorrectly could lead to disastrous problems with your operating system such as preventing it from ever starting again. Make sure that you save ComboFix.exe to your DesktopDisable your AntiVirus and AntiSpyware applications, usually via a right click on the System Tray icon. They may otherwise interfere with our tools

Double click on ComboFix.exe & follow the prompts.

As part of it's process, ComboFix will check to see if the Microsoft Windows Recovery Console is installed. With malware infections being as they are today, it's strongly recommended to have this pre-installed on your machine before doing any malware removal. It will allow you to boot up into a special recovery/repair mode that will allow us to more easily help you should your computer have a problem after an attempted removal of malware.

Follow... Read more

Read other 19 answers

Hello,My computer became infected last night, and It's pretty bad. I became infected with Infected: Trojan:Win32/Alureon.BT, Win32:Jifas-CY, and the others listed (maybe more). Long story short, I'd just watched Harry Potter on dvd, and logged onto the computer to see who he married in the end. I ended up at a Harry Potter encyclipdiea website, and looked it up. Avast went nuts after a few minutes, and showed 4 different virus alerts, and Windows Defender showed 1 as well after I shut down.The virus listed by Defender was Trojan:Win32/Alureon.BT. Avast listed Win32:Jifas-CY, I didn't get the others in time.The last 2 I listed in the title, a "security center alert" claimed it detected these programs trying to acess the internet. It listed one more, but I didn't get it's name in time.I know Alureon is a downloader and backdoor for other viruses, and it basically shuts down security systems, which it's trying to do since windows now thinks I have no anti-virus installed.All of these trojans are listed as "server" and "high risk." I'm not sure a root kit didn't try to make it's way in too.EDIT: I wanted to add a few things in. First, I have XP SP3 set up with multiple accouts, one admin "owner" account and then 1 limited access "user" account. The Viruses came in while the user account was logged on (I am not dumb enough to connect to the internet with an admin account). It seems the Viruses we... Read more

A:Infected: Trojan:Win32/Alureon.BT, Win32:Jifas-CY, Backdoor.Win32.Kbot.al, Net-Worm.Win32.Mytob.t

Hello again.I booted into Safe Mode and ran an Avast scan (which took forever) and it was a waste of time. The stupid thing found nothing wrong, and said the system was clean (which is the opposite it says when you log into the limited user account). The computer (and specially that account at least) is definitely infected. Could the viruses be hiding themselves when in safe mode?Should I scan from a Pre-install environment like BartPE? Or from the Regular "Owner" Admin account? I waited 2 days for the stupid program to scan 700gb (painfully slow for a qaud core, though to be excepted in safe mode), and it was useless.Other than running windows defender (which I'm doing now), and maybe trying MBAM, I'm not sure what to do. I'm not expect enough to dive into programs like OTViewIT and Combofix, so I'll need help here. Please, ANY HELP is appreciated. I would rather NOT wipe the drive and reinstall the whole system, but I need to get this figured out.Does no one have any ideas???

Read other 5 answers

Hello Bleeping!
A few days ago I removed Norton AV and installed MSSE. MSSE detected Trojan Dropper: Win32/Sirefef.B and Rogue:Win32/FakeRean. For the past two full system scans MSSE has detected and removed the dropper, and the last scan (last night) detected the Fake Rean. The MSSE removals don't appear to be effective against the dropper. Another peculiar thing, when I installed MSSE a few days ago, it told me my firewall was not up, but when I go into MS Security Center it says that the firewall is "ON". Not sure if perhaps the Norton AV removal maybe wasn't complete and that I am getting "false positives", or if something is really there. My logs are as follows:

DDS (Ver_2011-08-26.01) - NTFSx86
Internet Explorer: 7.0.5730.13 BrowserJavaVersion: 1.6.0_30
Run by Eric at 16:37:09 on 2012-02-09
Microsoft Windows XP Professional 5.1.2600.3.1252.1.1033.18.3069.2216 [GMT -5:00]
AV: Microsoft Security Essentials *Enabled/Updated* {EDB4FA23-53B8-4AFA-8C5D-99752CCA7095}
============== Running Processes ===============
C:\WINDOWS\system32\svchost.exe -k DcomLaunch
c:\Program Files\Microsoft Security Client\Antimalware\MsMpEng.exe
C:\Program Files\Trusteer\Rapport\bin\RapportMgmtService.exe
C:\WINDOWS\System32\svchost.exe -k netsvcs
C:\WINDOWS\system32\svchost.exe -k WudfServiceGroup
C:\WINDOWS\syste... Read more

A:Infected with Trojan Dropper: Win32/Sirefef.B AND Rogue: Win32 Fake Rean

Hello and Welcome to the forums! My name is Gringo and I'll be glad to help you with your computer problems. Somethings to remember while we are working together.Do not run any other tool untill instructed to do so!please Do not Attach logs or put in code boxes.Tell me about any problems that have occurred during the fix.Tell me of any other symptoms you may be having as these can help also.Do not run anything while running a fix.Do not run any other tool untill instructed to do so!Click on the Watch Topic Button and select Immediate Notification and click on proceed, this will help you to get notified faster when I have replied and make the cleaning process faster.Please print out or make a copy in notpad of any instructions given, as sometimes it is necessary to go offline and you will lose access to them.Run Combofix:You may be asked to install or update the Recovery Console (Win XP Only) if this happens please allow it to do so (you will need to be connected to the internet for this)Before you run Combofix I will need you to turn off any security software you have running, If you do not know how to do this you can find out >here< or >here<Combofix may need to reboot your computer more than once to do its job this is normal.You can download Combofix from one of these links.Link 1Link 2Link 3 1. Close any open browsers or any other programs that are open.2. Close/disable all anti virus and anti malware programs so they do not interfere with the r... Read more

Read other 18 answers

My computer has been infected with Win32/Rootkit.Agent.ODG trojan and Win32/Olmarik.JU trojan. AVG, ESET NOD32, and Avira couldn't delete it, and I want to delete it. It redirected all Google searches and slows down my computer. Can you please help me. Thanks ahead to anyone who can help.Here is the HJT logfile:Logfile of Trend Micro HijackThis v2.0.2Scan saved at 2:28:51 PM, on 18/08/2009Platform: Windows XP SP3 (WinNT 5.01.2600)MSIE: Internet Explorer v8.00 (8.00.6001.18702)Boot mode: NormalRunning processes:C:\WINDOWS\System32\smss.exeC:\WINDOWS\system32\winlogon.exeC:\WINDOWS\system32\services.exeC:\WINDOWS\system32\lsass.exeC:\WINDOWS\system32\Ati2evxx.exeC:\WINDOWS\system32\svchost.exeC:\Program Files\Windows Defender\MsMpEng.exeC:\WINDOWS\System32\svchost.exeC:\WINDOWS\system32\svchost.exeC:\WINDOWS\system32\ZoneLabs\vsmon.exeC:\Program Files\CheckPoint\ZAForceField\IswSvc.exeC:\WINDOWS\system32\LEXBCES.EXEC:\WINDOWS\system32\spoolsv.exeC:\WINDOWS\system32\LEXPPS.EXEC:\WINDOWS\Explorer.EXEC:\Program Files\Avira\AntiVir Desktop\sched.exeC:\Program Files\Avira\AntiVir Desktop\avguard.exeC:\Program Files\Common Files\Apple\Mobile Device Support\bin\AppleMobileDeviceService.exeC... Read more

A:Infected with Win32/Rootkit.Agent.ODG trojan and Win32/Olmarik.JU trojan

Hello and to Bleeping ComputerWe apologize for the delay in responding to your request for help. Here at Bleeping Computer we get overwhelmed at times, and we are trying our best to keep up. Please note that your topic was not intentionally overlooked. Our mission is to help everyone in need, but sometimes it takes just a little longer to get to every request for help. No one is ignored here.If you have since resolved the original problem you were having, we would appreciate you letting us know. If not please perform the following steps below so we can have a look at the current condition of your machine. If you have not done so, include a clear description of the problems you're having, along with any steps you may have performed so far.Upon completing the steps below another staff member will review and take the steps necessary with you to get your machine back in working order clean and free of malware.If you have already posted a DDS log, please do so again, as your situation may have changed.Use the 'Add Reply' and add the new log to this thread.Thanks and again sorry for the delay.-----------------------------------------------------------We need to see some information about what is happening in your machine. Please perform the following scan:Download DDS by sUBs from one of the following links. Save it to your desktop.DDS.scrDDS.pifDouble click on the DDS icon, allow it to run.A small box will open, with an explaination about the tool. No input is needed, ... Read more

Read other 20 answers

The last two days my computer has frozen up while trying to surf around online. This seemed weird so I ran a full system scan with symantec endpoint both days. Both times the logs came back with no risks detected. Today I started getting internet explorer pops directing me to sites. I knew at this point I had an infection that endpoint was not picking up. I disabled my network card and used another computer to download some of the suggest programs I've seen on this site. I has hoping to at least get the problem quarantined so that I would feel safe enough to enable the network card again. After running the utilities, I am not freezing when surfing web pages and have resumed using the computer. I would like help making sure that my computer is clean since endpoint obviously isn't catching this problem. Below are the logs for Kaspersky Online Scan & DSS.Deckard's System Scanner v20071014.68Run by bgedeon on 2008-07-29 14:40:22Computer is in Normal Mode.---------------------------------------------------------------------------------- HijackThis (run as bgedeon.exe) ---------------------------------------------Logfile of Trend Micro HijackThis v2.0.2Scan saved at 14:40, on 2008-07-29Platform: Windows XP SP3 (WinNT 5.01.2600)MSIE: Internet Explorer v6.00 SP3 (6.00.2900.5512)Boot mode: NormalRunning processes:C:\WINDOWS\System32\smss.exeC:\WINDOWS\system32\winlogon.exeC:\WINDOWS\system32\services.exeC:\WINDOWS\s... Read more

A:Infected With Trojan.win32.monder.bcb & Trojan-downloader.win32.agent.xxa

I continued to investigate on my own. Combofix quaratined some files, but did not delete them. A scheduled full system scan with endpoint finally picked up some infections with the newest updates loaded. Symantec scan labels the infections as Trojan.Vundo and Trojan.Metajuan. Metajuan was removed automatically, but Vundo proved to be a little more pesky. Symantec offers a removal tool for Vundo on there website. I opted to try out Malwarebytes' Anti-Malware (mbam). It was able to located the files that were in quaratine and some infected files that were in system restore. I disable system restore to avoid any problems and mbam was able to delete all the files. After a system restart, I scanned with Symantec Vundo tool and found no further signs of infection. Mbam did a good job Re-enabled system restore and recreated a fresh restore point. I'm hoping that this will be in the end of this problem, but would still be interested in someone combing through some of my logs to see if anything was missed. I'm still a little miffed that endpoint had not picked these infections up when they are not exactly new threats and I had the most current definitions when I ran my previous scans.

Read other 10 answers

i am sorry to post a log over here, as i have read through the forum and try to resolve the problem on my own but i failed.since i had ran the comboFix, so i feel that it may be of help to post it.sorry for the trouble..here's the log file...ComboFix 09-07-28.06 - Bentley 07/30/2009 0:35.1.8 - NTFSx86Microsoft? Windows Vista? Ultimate 6.0.6001.1.1252.1.1033.18.3069.1872 [GMT 8:00]Running from: c:\users\Bentley\Desktop\ComboFix.exeSP: SUPERAntiSpyware *disabled* (Updated) {222A897C-5018-402e-943F-7E7AC8560DA7}SP: Windows Defender *enabled* (Updated) {D68DDC3A-831F-4FAE-9E44-DA132C1ACF46} * Created a new restore point.((((((((((((((((((((((((((((((((((((((( Other Deletions ))))))))))))))))))))))))))))))))))))))))))))))))).c:\windows\Install.txtc:\windows\system32\tmp0_144047822718.bkc:\windows\system32\tmp0_16962678345.bkc:\windows\system32\tmp0_205418834021.bkc:\windows\system32\tmp0_355351885288.bkc:\windows\system32\tmp0_424346226483.bkc:\windows\system32\tmp0_516880812123.bkc:\windows\system32\tmp0_517948877969.bkc:\windows\system32\tmp0_525286544717.bkc:\windows\system32\tmp0_687442396617.bkc:\windows\system32\tmp0_77071886817.bkc:\windows\system32\tmp0_779592338841.bkc:\windows\system32\tmp0_790261416358.bkc:\windows\system32\tmp2_1075327197... Read more

A:Infected with win32/rootkit.agent.ODG trojan and win32/Olmarik.JU trojan

Hello and welcome to Bleeping ComputerWe apologize for the delay in responding to your request for help. Here at Bleeping Computer we get overwhelmed at times, and we are trying our best to keep up. Please note that your topic was not intentionally overlooked. Our mission is to help everyone in need, but sometimes it takes just a little longer to get to every request for help. No one is ignored here.If you have since resolved the original problem you were having, we would appreciate you letting us know. If not please perform the following steps below so we can have a look at the current condition of your machine. If you have not done so, include a clear description of the problems you're having, along with any steps you may have performed so far.Upon completing the steps below another staff member will review and take the steps necessary with you to get your machine back in working order clean and free of malware.If you have already posted a DDS log, please do so again, as your situation may have changed.Use the 'Add Reply' and add the new log to this thread.Thanks and again sorry for the delay.We need to see some information about what is happening in your machine. Please perform the following scan:Download DDS by sUBs from one of the following links. Save it to your desktop.DDS.scrDDS.pifDouble click on the DDS icon, allow it to run.A small box will open, with an explaination about the tool. No input is needed, the scan is running.Notepad will open with the results.Foll... Read more

Read other 2 answers

According to AVG I'm infected with Clicker.AAFT which appears as c:\windows\fonts\services.exe. Task Manager always has at least 2 of these additional services.exe running.I used to have Norton antivirus running but the virus broke it and i couldn't re-install it. I bought the Kaspersky Labs virus scanner but that to would not install. it looks like this virus has changed the "rights" of some objects. The only virus scanner that would install and work was AVG.I tried to re-install service pack 3 thinking it would possibly overwrite some of the virus infected files but I got an "access denied" when I tried to start installing... ARRRRRRRGGGGHHHH!!!!Any help would be much appreciated!/Blair Here's my DDS log: DDS (Ver_09-06-26.01) - NTFSx86 Run by Blair at 15:18:10.15 on 2009-07-11Internet Explorer: 7.0.5730.11Microsoft Windows XP Professional 5.1.2600.3.1252.1.1033.18.3071.2127 [GMT -4:00]AV: AVG Anti-Virus Free *On-access scanning enabled* (Updated) {17DDD097-36FF-435F-9E1B-52D74245D6BF}AV: Kaspersky Internet Security *On-access scanning disabled* (Updated) {2C4D4BC6-0793-4956-A9F9-E252435469C0}AV: ESET NOD32 antivirus system 2.70 *On-access scanning enabled* (Updated) {E5E70D32-0101-4F12-8FB0-D96ACA4F34C0}============== Running Processes ===============C:\WINDOWS\system32\svchost -k DcomLaunchsvchost.exeC:\WINDOWS\System32\svchost.exe -k netsvcsC:\WINDOWS\system32\sv... Read more

A:Infected with Clicker.AAFT Win32.Delf.rtk Win32.Agent.atta

I just noticed that I'm also infected with Virtumonde in


Read other 15 answers

Hi,I'm running Windows XP - Internet Explorer v. 6.00, SP3. Yesterday Avast alerted me to a virus on my computer (I neglected to write down the exact message). At the time, only Gmail was open and an email was being written. I've had some issues with Avast occasionally reporting a false positive, and since nothing was being downloaded at that time, I took no action with Avast. Instead, I immediately did a Quick Scan with MalwareBytes to see if it would find anything. MalwareBytes found and deleted the following: C:\Documents and Settings\HP_Owner\application data\Sun\Java\deployment\cache\\6.0\44\61b86cac-3c0c0928Trojan.FakeAlert.VGenC:\Documents and Settings\HP_Owner\local settings\temp\0.506697477033.exeTrojan.FakeAlert.VGenA second MalwareBytes scan was clean.I looked "Trojan.FakeAlert.VGen" up on Google and then it clicked: for the past few days, Adobe Flash Player has been crashing an awful lot. When it crashes (on Youtube, for example), it tells me the program is out of date and needs to be updated. The weird thing was that sometimes it worked for a while before it crashed, but I dismissed that as being some strange computer quirk. I went to the Adobe web site and tried to install the newest version of Flash Player, but was unable to. I feel foolish, but it never even occurred to me that a virus could be to blame. It concerns me that (assuming the Adobe Flash Pla... Read more

A:Trojan.FakeAlert.VGen, SpyInstall_HPPre.exe, Win32: Mirc-z [PUP], Win32: Kill App-W [PUP] & Win32: Agent-AMXO (Trj)

Download Security Check from HERE, and save it to your Desktop. * Double-click SecurityCheck.exe * Follow the onscreen instructions inside of the black box. * A Notepad document should open automatically called checkup.txt; please post the contents of that document.=============================================================================Please download MiniToolBox and run it.Checkmark following boxes:Report IE Proxy SettingsReport FF Proxy SettingsList content of HostsList IP configurationList last 10 Event Viewer logList Users, Partitions and Memory sizeClick Go and post the result.=============================================================================Download Malwarebytes' Anti-Malware (aka MBAM): http://www.malwarebytes.org/products/malwarebytes_free to your desktop. * Double-click mbam-setup.exe and follow the prompts to install the program. * At the end, be sure a checkmark is placed next to Update Malwarebytes' Anti-Malware and Launch Malwarebytes' Anti-Malware, then click Finish. * If an update is found, it will download and install the latest version. * Once the program has loaded, select Perform quick scan, then click Scan. * When the scan is complete, click OK, then Show Results to view the results. * Be sure that everything is checked, and click Remove Selected. * When completed, a log will open in Notepad. * Post the log back here.Be sure to restart the computer.The log can also be found here:C:\Document... Read more

Read other 13 answers

Hello!I have trouble with my computer. I found this forum online and now I hope that you can help me. I suspected that I had a virus so I installed a anti-virus program. It found files with the names virus.win32.sality.k and trojan-proxy.win32.agent.II on my computer. After desinfecting those files I always got an error message when I turned the computer on. It kept telling me: file vmmdiag32.exe cannot be found. Then I found this forum and saw that other people had the same problem and that this is still a consequence of the virus. I don?t know how to get rid of it.Then I found your preparation guide for use before posting a hijackthis log, and checked my computer with the programs you adviced. Now that errormessage has disappeared, but I have the impression that my computer doesn?t work properly anymore. It?s getting slower and the anti-virus programm always finds new infected files. Sometimes when I turn the computer on it gets stuck while it is booting up and I have to press F1 to continue.Now there?s a problem with the audio too - I don?t know if it is also a result of the virus. It tells me: bad directsound driver. please install proper drivers or select another device in configuration. error code: 88780078. and the only sound the computer makes is a terrible peep sound.I have never had a virus before (I didn?t have internet on my computer), so I?m a little bit helpless and I would really appreciate it if you could help me.I also did the Hijackthis. here is the res... Read more

A:Infected With: Virus.win32.sality.k; Trojan-proxy.win32.agent.ii

Hi schag1,

If you still need help please post a fresh HijackThis log and I'll be happy to look at it for you.

Thanks for your patience.

Read other 6 answers

Hi members,

I have this problem since last two days. I'm using Kaspersky and last two days, while I was using one of the software (.exe), Kaspersky popped up a message saying one of my files was infected with this Trojan-Dropper.Win32.Delf.ech

Kaspersky suggested to restart where it will delete the infected file. So I did. Then, I reinstalled the software and scanned it with Kaspersky. Everything is fine. But the moment I used this exe file again, the same warning appeared again. One of my friends suggested that I use ComboFix.exe but this problem still exist after all.

Anyone can solve this problem?? I'm desperately look for solutions here because I cannot use this exe file to run certain application. Other friends who use this exe file have no problem except me.



What program are you trying to use?Did Kaspersky provide a specific file name associated with the malware threat(s) detection and if so, where is it located (full file path) at on your system? The detection on that file may be a false positive. Anytime you suspect a file may be a false positive, get a second opinion. Go to Jotti's virusscan or VirusTotal. In the "File to upload & scan" box, browse to the location of the suspicious file(s) and submit (upload) it for scanning/analysis.If it is a false detection, then you should contact the anti-virus tech support and advise them so they can investigate and make corrections. Most anti-virus vendors have instructions for file submissions posted on their web sites. Once a file is received, a technician can examine it in more detail and provide a report letting you know the results. You should also contact and advise the program vendor that one of their files is being detected as a threat. In many cases they will work with the anti-virus techs in an attempt to resolve the detection.

Read other 5 answers

OK Nomally I goto google, and read past bleeping computer related topics to the three viruses I listed in the topic, or for anything. But this crap takes the cake. Ive never delt with garbage like this.

I just moved into a new neighborhood, and have been looking for an unsecured internet for a while. Someone just brought one online friday. But when I connected to it (which its what Im connected to now) Trojans started popping up out of nowhere. Ive run Hijackthis and SDfix and will put the logs at the bottom. SD Fix seems to find the viruses, but cannot delete them properly. Itll find them delete them then list hidden attributes, which are still viruses, and not delete them. These little buggers are tricky.

So if someone could please help me out here. It keeps trying to send mass loads of spam mails. Ive also reformated about 4 times now. Its giving false positives in the ask manager running proccesses. svchost, IEXPLORER (listed under system, its supposed to be listed under HP_Owner for me not to mention its in caps), random charactered trojans that google has no info on, winlogin.exe is all messed up. MY LoginUI wont work properly anymore. and all of them are listed as exe in places they shouldnt be. Anyways heres the logs, Im gonna TRY to play some runescape while I wait for an answer.

One more thing, Computer is running slow, dont know if i can run spybot or counterspy again. LOL speaking of which Counterspy's Safe mode scan wont even run. PERIOD. So yeah:
Edit. Runn... Read more

A:Infected with PWS.LDPinchIE, Win32.Delf.uc, Win32.Agent.pz

Hello! My name is Sam and I will be helping you. In order to see what's going on with your computer I will ask for you to post various logs from the tools that we will use to resolve your issue. Please also share with me any information about how your computer is reacting and behaving each step of the way as we work through this process.We need to create an OTListIt2 ReportPlease download OTListIt2 from hereSave it to your desktop.Double click on the icon on your desktop.Click the "Scan All Users" checkbox.Push the "Run Scan" button.The scan should take just a few minutes.Copy the log that opens up and paste it back here in your next reply.=============The next log will show us any hidden files that are present.Download GMER from here:Unzip it to the desktop.Open the program and click on the Rootkit tab.Make sure all the boxes on the right of the screen are checked, EXCEPT for ?Show All?.Click on Scan.When the scan has run click Copy and paste the results (if any) into this thread.

Read other 1 answers

I use ESET NOD32. At startup it detects the win32/Kryptik in a start-up scan and later mentions the Win32 rootkit running in memory. The scan log shows that it has detected this on each startup but it cannot delete because files are locked from removal. I have not been able to tell what file NOD is trying to find. Below is last log file post: This same message is repeated in numerous 10+ restarts in the past 24 hours.

5/19/2009 8:25:51 PM Startup scanner file \\?\globalroot\systemroot\system32\gxvxctxujtymqsiltimrpcilnqyirvmqgrlhk.dll a variant of Win32/Kryptik.PF trojan cleaned by deleting (after the next restart) - quarantined
5/19/2009 8:25:46 PM Startup scanner operating memory Operating memory Win32/Rootkit.Agent.ODG trojan unable to clean

I have run ESET in safe mode. It didnot do anything to eliminate the problem. Windows Defender has apparently not done anything either. Finally, I tried windows malicious software removal, but apparently it could not do anything either.

Main problem I notice is delays in internet usage. Happens both in firefox and ie. I changed DNS settings from automatically detect to a fixed DNS setting from earthlink.net. Still same slow down in internet usage.

Appreciate any help you can give. I have tried to find bad file, but to no avail.


DDS (Ver_09-05-14.01) - NTFSx86
Run by Pop at 21:38:42.70 on Tue 05/19/2009
Internet Explorer: 7.0.... Read more

A:Infected with Win32/Krptik.PF and win32/Rootkit.agent.odg.trojan

It now looks like I may have been able to repair my problem. I used a somewhat, haphazard, unguided approach to removal. The final solution came from AVG Rootkit removal ( http://download.cnet.com/AVG-Anti-Rootkit-...4-10662685.html ). Here is a list of all the steps I attempted. I was worried at times I could have hurt my system, but then I would have had to reinstall the OS. But, on the other hand, some internet posts I read were saying that was the only way to repair the situation. So, desperation took hold. I found my reinstall disks, just in case I needed them and proceeded. ATF Cleaner -- Who needs temp files anyway, especially if they might have trojans, I eliminated temp files this program would find.CC Cleaner - used this to clean out internet cache and history.Recycler folders - I had multiple recycler folders, one that had a rundll in it. I assumed you only have one recycle bin so you only need one of these folders. I had to reset the folder view options in exlorer to see all files and folders (hidden, system, etc.) I deleted the extra recycler folders I could find.System Restore - I turned off system restore. This would erase all the previous positions I had saved. This meant I could never go back to a prior position where my computer was running good, but I didn't know how to find out if I had virus/trojan in one of these saved files I then immediately turned back on the system restore after the old restore files were deleted.b]Windows defender[... Read more

Read other 2 answers

My computer is infected with Win32.Trojan.Tdss and Win32.TrojanDownloader.Agent. I've been trying to remove them with Ad-Aware but they re-install themselves. I've downloaded numorous other malware removers but the malware seems to disrupt / won't allow them to install or work. This includes the root repeal program mentioned in the preparation guide. When I attempt to run root repeal I get the following error:

04:03:06: FOPS - DeviceIoControl Error! Error Code = 0xc0000024 Extended Info (0x000000d8)
04:03:06: DeviceIoControl Error! Error Code = 0x1e7
04:03:06: FOPS - DeviceIoControl Error! Error Code = 0xc0000024 Extended Info (0x000000d8)

The most annoying thing that is happening is when I go to google something, it will redirect me to somewhere else or will throw random pop-ups at me every now and then. Also, I tried to reformat / re-install a fresh copy of Windows Vista but it seems this piece of malware makes it impossible to boot from disk.

Thank you in advance for your assistance!

Attached below is my dds.txt log:

DDS (Ver_09-07-30.01) - NTFSx86
Run by Jeff at 3:59:19.84 on Fri 08/28/2009
Internet Explorer: 7.0.6000.16890
Microsoft? Windows Vista???? Home Premium 6.0.6000.0.1252.1.1033.18.2046.1362 [GMT 9:00]

SP: Lavasoft Ad-Watch Live! *disabled* (Updated) {67844DAE-4F77-4D69-9457-98E8CFFDAA22}
SP: Windows Defender *enabled* (Updated) {D68DDC3A-831F-4FAE-9E44-DA132C1ACF46}

============== Running Processes ===============

C:\... Read more

A:Infected With Win32.Trojan.Tdss and Win32.TrojanDownloader.Agent

Hello and welcome to Bleeping ComputerWe apologize for the delay in responding to your request for help. Here at Bleeping Computer we get overwhelmed at times, and we are trying our best to keep up. Please note that your topic was not intentionally overlooked. Our mission is to help everyone in need, but sometimes it takes just a little longer to get to every request for help. No one is ignored here.If you have since resolved the original problem you were having, we would appreciate you letting us know. If not please perform the following steps below so we can have a look at the current condition of your machine. If you have not done so, include a clear description of the problems you're having, along with any steps you may have performed so far.Upon completing the steps below another staff member will review and take the steps necessary with you to get your machine back in working order clean and free of malware.If you have already posted a DDS log, please do so again, as your situation may have changed.Use the 'Add Reply' and add the new log to this thread.Thanks and again sorry for the delay.We need to see some information about what is happening in your machine. Please perform the following scan:Download DDS by sUBs from one of the following links. Save it to your desktop.DDS.scrDDS.pifDouble click on the DDS icon, allow it to run.A small box will open, with an explaination about the tool. No input is needed, the scan is running.Notepad will open with the results.Foll... Read more

Read other 3 answers

Just yesterday I appear to have found contracted a virus. No matter what method I use to remove it, everytime I restart my computer, it is back. Hopefully someone will be able to help me. Per Ad-Ware, this is what was found:
Trojan.Win32.Generic!BT - c:\windows\system32\d-link_st3402.dll
Win32.Trojan.Agent - c:\windows\system32\d-link_st3402.dll

I ran the MiniToolBox and have attached the results of that. I tried running going into safe mode and running RKill, then SAS, then rebooting into normal mode and running MBAN but it always seems to come back. I also attached the MBAN log as well.

I hope someone can help, otherwise it looks like a long night of reformatting is ahead of me......

MiniToolBox by Farbar Version: 18-01-2012
Ran by Andrew Kuntze (administrator) on 06-04-2012 at 15:20:34
Microsoft Windows 7 Ultimate Service Pack 1 (X86)
Boot Mode: Normal

========================= Flush DNS: ===================================

Windows IP Configuration

Successfully flushed the DNS Resolver Cache.

========================= IE Proxy Settings: ==============================

Proxy is not enabled.
No Proxy Server is set.

"Reset IE Proxy Settings": IE Proxy Settings were reset.
========================= Hosts content: =================================

::1 localhost localhost

========================= IP C... Read more

A:Trojan.Win32.Generic!BT & WIN32.Trojan.Agent HELP!!!!!!!!!!

Hello, appears you have contracted a deep seated ZeroAccess Rootkit,probably from a torrent download.To get this out we need a deeper look. Please go here....Preparation Guide ,do steps 6-9.Create a DDS log and post it in the new topic explained in step 9 which is here Virus, Trojan, Spyware, and Malware Removal Logs and not in this topic,thanks.If GMER won't run skip it and move on.Let me know if that went well.

Read other 3 answers

I have a nasty infection that has taken over my machine and which I cannot remove. The infection seems to hijack the google page and any links that I click from this page take me to what appears to be rogue websites, which want me to download their stuff.

I am currently running ESET Nod 32 and Ad-aware Anniversary Edition. Both these programs are picking up the trojan infections but are unable to clean.

I have tried to install malwarebytes but have been unable to do so. I did try changing the exe name of malwarebytes (as advised on this site) but the program does not fully complete the installation.

I have downloded the DDS tool, ran the scan and have now attached the lod to this post.

Also here is a copy of the Ad-aware scan log (I did not complete the scan due to the computer constantly crashing):

Logfile created: 10/06/2009 18:19:4
Lavasoft Ad-Aware version: 8.0.5
Extended engine version: 8.1
User performing scan: SYSTEM

*********************** Definitions database information ***********************
Lavasoft definition file: 148.49
Extended engine definition file: 8.1

******************************** Scan results: *********************************
Scan profile name: Smart Scan (ID: smart)
Objects scanned: 70104
Objects detected: 7
Type Detected
Processes.......: 1
Registry entries: 0
Hostfile entries: 0
Files...........: 6
Folders.........: 0
LSPs............: 0
Cookies............ Read more

A:Infected with WIN32 Trojan Agent and WIN32 trojan TDSS

Hello. I am PropagandaPanda (Panda or PP for short), and I will be helping you.Disable Realtime ProtectionAntimalware programs can interfere with ComboFix and other tools we need to run. Please temporarily disable all realtime protections you have enabled. Refer to this page, if you are unsure how.Download and Run ComboFixDownload Combofix by sUBs from any of the links below, and save it to your desktop.Link 1, Link 2, Link 3 Close/disable all anti-virus and anti-malware programs so they do not interfere with the running of ComboFix. Refer to this page if you are not sure how.Double click on ComboFix.exe and follow the prompts. If you are using Windows Vista, right click the icon and select "Run as Administrator". You will not recieve the prompts below if you are not using Windows XP. ComboFix will check to see if you have the Windows Recovery Console installed.If you did not have it installed, you will see the prompt below. Choose YES.
When the Recovery Console has been installed, you will see the prompt below. Choose YES.
When finished, ComboFix will produce a report for you. Please post the contents of the log (C:\ComboFix.txt).Leave your computer alone while ComboFix is running. ComboFix will restart your computer if malware is found; allow it to do so.Download and Run Scan with GMERWe will use GMER to scan for rootkits.Please download GMER to your desktop. Note that the file will be randomly named to prevent active malware from stopping the download.Close all other ope... Read more

Read other 7 answers

Hi! My real-time Anti-virus protection filter (Eset Nod32) has registered som virus activity for the past couple of weeks that i cant seem to get rid of:2010-03-22 11:26:47 Real-time file system protection file I:\System Volume Information\_restore{9307B358-B690-49BE-8C17-30DE253AE1DB}\RP828\A0122539.exe probably a variant of Win32/Agent trojan cleaned by deleting - quarantined NT INSTANS\SYSTEM Event occurred on a file modified by the application: C:\WINDOWS\System32\svchost.exe.2010-03-22 10:34:42 Real-time file system protection file E:\System Volume Information\_restore{9307B358-B690-49BE-8C17-30DE253AE1DB}\RP828\A0123560.exe a variant of Win32/Kryptik.W trojan cleaned by deleting - quarantined NT INSTANS\SYSTEM Event occurred on a file modified by the application: C:\WINDOWS\System32\svchost.exe.2010-03-22 10:34:36 Real-time file system protection file I:\System Volume Information\_restore{9307B358-B690-49BE-8C17-30DE253AE1DB}\RP828\A0122537.exe probably a variant of Win32/Agent trojan cleaned by deleting - quarantined NT INSTANS\SYSTEM Event occurred on a file modified by the application: C:\WINDOWS\System32\svchost.exe.The files (same trojan /s but different executable names after each deletion, for ex: it varies between A0005757.exe, A0005757.inf and svchost.exe and so on) comes keep comming back after deletion of files in qurantine. The DDS l... Read more

A:Infected by Win32/Agent & Win32/kryptik.W Trojan

Hello and welcome to Bleeping ComputerWe apologize for the delay in responding to your request for help. Here at Bleeping Computer we get overwhelmed at times, and we are trying our best to keep up. Please note that your topic was not intentionally overlooked. Our mission is to help everyone in need, but sometimes it takes just a little longer to get to every request for help. No one is ignored here.If you have since resolved the original problem you were having, we would appreciate you letting us know. If not please perform the following steps below so we can have a look at the current condition of your machine. If you have not done so, include a clear description of the problems you're having, along with any steps you may have performed so far.Upon completing the steps below another staff member will review and take the steps necessary with you to get your machine back in working order clean and free of malware.If you have already posted a DDS log, please do so again, as your situation may have changed.Use the 'Add Reply' and add the new log to this thread.Thanks and again sorry for the delay.We need to see some information about what is happening in your machine. Please perform the following scan:Download DDS by sUBs from one of the following links. Save it to your desktop.DDS.scrDDS.pifDouble click on the DDS icon, allow it to run.A small box will open, with an explaination about the tool. No input is needed, the scan is running.Notepad will open with the results.Foll... Read more

Read other 3 answers

Hi bleeping computer helpers,I was infected by the worm.win32.autorun.avz which quickly overwhelmed my AVG scanner which was up to date and operating at the time.I installed Kaspersky Internet Security and it found over 230 examples of the autorun worm as well as lots of the trojan PSW.Win 32.OnLineGames.lej (and numberous other OnLineGames.---) as listed above. At first the virus was restarted every time I restarted the computer but now I have "clean" results from Kaspersky after multiple full system scans.I have also done the following as per the instructions in the prep guide:- Cleaned out temp files- scanned with Ad-Aware and Spybot- scanned with Housecall, Panda and Bit Defender- Run McAfee AVERT stinger- my Kaspersky firewall is active- I have the latest Windows Updates downloaded and installedAll of these came back with a "clean" report with the following exceptions which I believe to be false positives based on googling the name of the "problem".One or more of the scanners objected to the following issues:LvPrcSrve.exe which I believe is a valid part of the Logitech Quickcamwltrysvc.exe which I believe is part of the Belkin Wireless strength monitorKeylogger \Driver\mhk which I believe is part of my BestCrypt programSbRecovery.ini which I believe is part of Spybotsvchost.exe which I believe is a part of Windows despite Kaspersky telling me 5-6 times in a row that an "executable file has been modified since last s... Read more

A:Worm.win32.autorun.avz And Trojan-psw.win32.onlinegames.lej And Also Ending W/ .lek .isb .loi .leh .hfr

Hello GDW and welcome to the BC HijackThis forum. Let's see what else shows up with a different scanner.Before running the scan let's clean out the temporoary folders. Download ATF Cleaner to your Desktop.Double-click ATF-Cleaner.exe to run the program.Click Select All found at the bottom of the list.Click the Empty Selected button.If you use Firefox browser, do this also:Click Firefox at the top and choose Select All from the list.Click the Empty Selected button.NOTE : If you would like to keep your saved passwords, please click No at the prompt.If you use Opera browser, do this also:Click Opera at the top and choose Select All from the list.Close ALL Internet browsers (very important).Click the Empty Selected button.NOTE : If you would like to keep your saved passwords, please click No at the prompt.Click Exit on the Main menu to close the program.Now download WinPFind35u.exe to your Desktop and double-click on it to extract the files. It will create a folder named WinPFind35u on your desktop.Note: You must be logged on to the system with an account that has Administrator privileges to run this program.Close ALL OTHER PROGRAMS.Open the WinPFind3u folder and double-click on WinPFind35U.exe to start the program (if you are running on Vista then right-click the program and choose Run as Administrator).Check the box for Include MD5 on the toolbar.In the Drivers section click on Non-Microsoft.Under Additional Scans click the checkboxes in front of the following items to select ... Read more

Read other 6 answers

Hi computer gods,
My AVG antivirus program picked up a Trojan horse Dropper.Delf.BLA and Virus Win32/PolyCrypt on my computer. They were found in the following locations on my computer.

Trojan Horse Dropper.Delf.BLA in C:Sytem Volume Information/_restore{46DE8921-1d39-44D2-A9E9-64119261F211}/RP4/A0000013.dll

Win32/PolyCrypt in C:Sytem Volume Information/_restore{46DE8921-1d39-44D2-A9E9-64119261F211}/RP7/A0000217.exe

Trojan horse Dropper.Delf.BLA in C:/WINDOWS/system32/splm/ncjapi32.exe ; this was detected in the registry key as well.

Win32/PolyCrypt was found in C:/WINDOWS/system32/splm/kbdsapi.dll earlier this week.

It have also previously picked up another type of Trojan horses (ex. Sheur.Cazb) and tracking cookies. All of which have been moved to the virus vault of AVG. Below is the logfile.

Logfile of Trend Micro HijackThis v2.0.2
Scan saved at 3:04:25 PM, on 9/7/2008
Platform: Windows XP SP2 (WinNT 5.01.2600)
MSIE: Internet Explorer v8.00 (8.00.6001.18241)
Boot mode: Normal

Running processes:
C:\Program Files\Microsoft Small Business\Business Contact Manager\BcmSqlStartupSvc.exe
C:\P... Read more

Read other answers

Hi, I?m a newbie and this is my first post. Thanks ahead of time for existing and for helping me!My computer is an HP,AMD Athlon 64x2, 1.0GB RAM, WIN XPsp2 desktop with lots of virus/Trojan/adware/malwareNot sure where they all came from but the surfing the web for fantasy football stuff yesterday morning and landing on www.athlonsports.[com] or www.grogansports.[com] was the final virus that started me crashing and generating the wonderful ?Error Message: Stop c000021a {Fatal System Error} The Session Manager Initialization System Process??After failing to reboot multiple times and not being able to use my XP recovery disks, the computer loaded up somehow in Normal Mode. I disconnected from the Internet and I ran Avast! Antivirus before it crashed again and it found the following virus/etc.Found by Avast! AntivirusJS:Redirector-B[Trj] in a temporary internet fileWMA:Wimad[Drp] in a temporary internet fileWin32:Monder-GB[Trj]? in ?c:windows\system32\opnmlccs.dll? file?Win32:Trojan-gen{Other}? in ?c:\Windows\system32\prunnet.exe? file ?Win32:adware-gen[Adw]? in a program that came with computer that I?ve never used: C:\program files\online services\peoplepc\isp5900\branding\ppal3ppc.exe\$instdir\ppcttoolbar.dllI deleted/quarantined those viruses and tried to do a system restore to a couple days before and it wouldn't let me do it although I had just saved a system restore on 12/31. And t... Read more

A:Win32:Monder-GB[Trj], Win32:Trojan-gen{Other}, Adware.PopCap, Trojan.Vundo, Trojan.Agent and more

Seneka Rootkit Please read this post by Quietman7http://www.bleepingcomputer.com/forums/ind...t&p=1074915and tell us how you want to procedeYou might want to procede with a partial cleanup so you can finish backing up those pictures

Read other 6 answers

Hello,My name is Raj and I am a new member to this forum. Let me thank you, first of all, for all the help you all provide with solving these nasty issues. Now here is my situation.My problems started when my IE web pages did not load inspite of having good wireless connection. I ran AVG free and got the web browsing back. But then my CMD and regEdit tools would not work. I ran Spybot S&D but it did fix my issue. In addition my desktop stopped loading. I could use ctrl+alt+delete to get task manager and then use File -> Create New task to run explorer.exe. This would get my desktop back but only intermittently. Then I decided to buy Kaspersky. I was totally disappointed with it. It detected several malware but it could not cure Trojan-Clicker.win32.delf.cbe and Rootkit.win32.podnuha.a infections. It would try to delete these files, ask me to restart the computer and would not delete the files after the restart. Each time I restart the computer, it would detect these, try to delete, ask me to restart and the cycle continued. On top of the I lost my CMD and reggedit tools again. I tried to run dds.scr with the hope of getting you all the dds logs but my CMD tool does not work. In addtion whenever I tried to run 'cmd' I would lose my desktop (if I happend to get it back comehow).So instead of giving you attach.txt I can only give HT logs at this point. Hope you can help me out and I appreciate your help very much.ThanksRaj P.S : I could not attached the log... Read more

A:Trojan-Clicker.win32.delf.cbe and Rootkit.win32.podnuha.a infections

Hello! My name is Sam and I will be helping you. In order to see what's going on with your computer I will ask for you to post various logs from the tools that we will use to resolve your issue. Please also share with me any information about how your computer is reacting and behaving each step of the way as we work through this process.We need to create an OTListIt2 ReportPlease download OTListIt2 from hereSave it to your desktop.Double click on the icon on your desktop.Click the "Scan All Users" checkbox.Push the "Run Scan" button.The scan should take just a few minutes.Copy the log that opens up and paste it back here in your next reply.=============The next log will show us any hidden files that are present.Download GMER from here:Unzip it to the desktop.Open the program and click on the Rootkit tab.Make sure all the boxes on the right of the screen are checked, EXCEPT for ?Show All?.Click on Scan.When the scan has run click Copy and paste the results (if any) into this thread.

Read other 12 answers

(DDS log below)I re-installed my AV after running without it for a while and found that I had quite a few bad things going on picked up by Nod32 including (see attachment for more detail):Win32/Olmarik.ZCJava/TrojanDownloader.Agent.NBEa variant of Win32/Olmarik.UL trojanWin32/Cimag.CL trojanI also get multiple outbound connection attempts which are at least partially being blocked by Nod32 to weird .cc .cn and a few .com domain urls, this happens after performing a google search. Also getting some browser redirects going on and homepage changes.I tried setting nod32 to pre-release updates and performing a full scan, this picked up the above and removed them, but after a reboot there are still things going on. Before reading the steps on this site, I ran the latest ComboFix twice which picked up a rootkit in intelide.sys both times, but appears to come back each time. While I disabled nod32 when I ran ComboFix, it re-enabled upon reboot automatically, not sure if that matters.I've also been getting a startup delay of around 1 minute after logon, in this time, nothing appears to be going on (no apparent CPU or disk activity), but wireless, AV and other startup items do not run. Then a minute later, everthing fires up.I've tried running GMER several times but this keeps giving me a BSOD with IRQL_NOT_LESS_OR_EQUALLast scan with nod32 came up clean but still getting outbound connections and browser redirects.Looking to sort this out once and for all!DDS (Ver_10-03-17.... Read more

A:WinXP rootkit? problem + Win32/Olmarik.ZC Java/TrojanDownloader.Agent.NBE a variant of Win32/Olmarik.UL trojan Win32/Cimag.CL t...

Hi,Welcome to Bleeping Computer. My name is m0le and I will be helping you with your log.Please subscribe to this topic, if you haven't already. You can subscribe by clicking the Options box to the right of your topic title and selecting Track This Topic.Please avoid installing/uninstalling or updating any programs and attempting any unsupervised fixes or scans. This can make helping you impossible.Please reply to this post so I know you are there.The forum is busy and we need to have replies as soon as possible. If I haven't had a reply after 3 days I will bump the topic and if you do not reply by the following day after that then I will close the topic.----------------------------------------------Please download GMER from one of the following locations and save it to your desktop:Main MirrorThis version will download a randomly named file (Recommended)Zipped MirrorThis version will download a zip file you will need to extract first. If you use this mirror, please extract the zip file to your desktop.Disconnect from the Internet and close all running programs.Temporarily disable any real-time active protection so your security programs will not conflict with gmer's driver.Double-click on the randomly named GMER file (i.e. n7gmo46c.exe) and allow the gmer.sys driver to load if asked.Note: If you downloaded the zipped version, extract the file to its own folder such as C:\gmer and then double-click on gmer.exe.GMER will open to the Rootkit/Malware tab and perfor... Read more

Read other 14 answers

Hello!I got a warning from my NOD32 that the files C:\autorun.inf and later D:\autorun.inf is infected by win32/psw.onlinegames.nnu trojan.The file was put in quarantine but the message keep poping up. Now I have tried to delete the files through dos, used Spybot - S and D and McAfee Stinger and then i mannaged to delete the files using a scan and clean with NOD32. So now my antivirusprogram cant find the virus. The only problem that i experienced before was that i cant see hidden files and folders. This is still the problem.I have run Hijack this.Here is the log:Logfile of Trend Micro HijackThis v2.0.2Scan saved at 12:48:45, on 2008-08-26Platform: Windows XP SP2 (WinNT 5.01.2600)MSIE: Internet Explorer v7.00 (7.00.6000.16705)Boot mode: NormalRunning processes:C:\WINDOWS\System32\smss.exeC:\WINDOWS\system32\csrss.exeC:\WINDOWS\system32\winlogon.exeC:\WINDOWS\system32\services.exeC:\WINDOWS\system32\lsass.exeC:\WINDOWS\system32\Ati2evxx.exeC:\WINDOWS\system32\svchost.exeC:\WINDOWS\system32\svchost.exeC:\Program\TuneUp Utilities 2006\WinStylerThemeSvc.exeC:\WINDOWS\System32\svchost.exeC:\WINDOWS\system32\svchost.exeC:\WINDOWS\system32\svchost.exeC:\WINDOWS\system32\Ati2evxx.exeC:\WINDOWS\System32\wltrysvc.exeC:\WINDOWS\System32\bcmwltry.exeC:&... Read more

A:Infected With Win32/psw.onlinegames.nnu Trojan

Hello Pseudomonas and welcome at BleepingComputer,Sorry to have kept you waiting for so long, but the forums are really busy.If you still need help :1. * Clean your Cache and Cookies in IE:Close all instances of Outlook Express and Internet Explorer Go to Control Panel > Internet Options > General tabUnder Browsing History, click Delete. Click Delete Files, Delete cookies and Delete historyClick Close below.* Clean your Cache and Cookies in Firefox (In case you also have Firefox installed):Go to Tools > Options.Click Privacy in the menu..Click the Clear now button below.. A new window will popup what to clear.Select all and click the Clear button again.Click OK to close the Options window* Clean other Temporary files + Recycle bin Go to start > run and type: cleanmgr and click ok. Let it scan your system for files to remove. Make sure Temporary Files, Temporary Internet Files, and Recycle Bin are the only things checked.Press OK to remove them.2. Please visit this webpage for instructions for downloading and running ComboFix:http://www.bleepingcomputer.com/combofix/how-to-use-combofixPlease ensure you read this guide carefully and install the Recovery Console first.The Windows Recovery Console will allow you to boot up into a special recovery mode, in case your computer has a problem after an attempted removal of malware. This allows us to help you. (WinXP SP3 users, please download the appropriate SP2 file, Home or Pro, to install the RC)In the event you alread... Read more

Read other 1 answers

Dear friends in BC

Pl note that I am resending this request as I did not get any replies from ur team to my post which I mailed on 27th June.

I am indebted to you all for the help and knowledge I am receiving from time to time from your end. It is a wonderful & selfless service you are doing to all the computer fraternity around the Globe and it is absolutely amazing. I have not only benefited by your expert advise but also have created awareness among all my friends about your website and the quality of advise one gets here. Needless to say that they all have become regular visitors to this site. Long live "Bleeping Computer" and wish you all the best.

Of late, I have been observing erratic behaviour in my laptop and realised that it must have been infested. Though it is a old laptop, it is not slow under normal circumstances.I have Nod32 Anti virus which normally loads at the startup and starts running. But since the infection, I saw that NOD32 took too much time to load. I also had Adaware in the system which also started to behave erratically. Whenever I went for definition update, an error message used to come. I could still manage to scan the computer using Adaware but it did not detect anything other than some MRU items.But NoD32 scan resulted in finding the Win32/PSW.OnLineGames.NNU trojan which was quarantined. But soon I realised that I could no more see my hidden & system files. This option is not working now. When I go to folder option> vie... Read more

A:Infected with win32/PSW.OnLineGames.NNU trojan

Please download Malwarebytes Anti-Malware and save it to your desktop.alternate download link 1alternate download link 2MBAM may "make changes to your registry" as part of its disinfection routine. If using other security programs that detect registry changes (ie Spybot's Teatimer), they may interfere or alert you. Temporarily disable such programs or permit them to allow the changes.Make sure you are connected to the Internet.Double-click on mbam-setup.exe to install the application.When the installation begins, follow the prompts and do not make any changes to default settings.When installation has finished, make sure you leave both of these checked:Update Malwarebytes' Anti-MalwareLaunch Malwarebytes' Anti-MalwareThen click Finish.MBAM will automatically start and you will be asked to update the program before performing a scan.If an update is found, the program will automatically update itself. Press the OK button to close that box and continue.If you encounter any problems while downloading the definition updates, manually download them from here and just double-click on mbam-rules.exe to install.On the Scanner tab:Make sure the "Perform Quick Scan" option is selected.Then click on the Scan button.If asked to select the drives to scan, leave all the drives selected and click on the Start Scan button.The scan will begin and "Scan in progress" will show at the top. It may take some time to complete so please be patient.When the scan is finished, a message box will say "The... Read more

Read other 18 answers

My system is infected with Win32/PSW.OnLineGames.MUU trojan in file C:\WINDOWS\system32\amvo.exe (infected file)I am unable to set my windowsExplorer options to "show hidden files and folders" and a file named Autorun.inf is there in every partition/drive...in the root directory. The problem was found while using Microsoft Internet Explorer 6.0This was detected by my Antivirus, "NOD32 v2.0" I dont know from where it came from...as I am a knowledgeable person and i scan every file on www.virustotal.com Every file that I download. StartupList report, 4/3/2008, 1:27:43 AMStartupList version: 1.52.2Started from : D:\HijackThis.EXEDetected: Windows XP SP2 (WinNT 5.01.2600)Detected: Internet Explorer v6.00 SP2 (6.00.2900.2180)* Using default options* Including empty and uninteresting sections* Showing rarely important sections==================================================Running processes:C:\WINDOWS\System32\smss.exeC:\WINDOWS\system32\winlogon.exeC:\WINDOWS\system32\services.exeC:\WINDOWS\system32\lsass.exeC:\WINDOWS\system32\svchost.exeC:\WINDOWS\System32\svchost.exeC:\WINDOWS\system32\svchost.exeC:\WINDOWS\system32\spoolsv.exeC:\WINDOWS\Explorer.EXEC:\Program Files\Grisoft\AVG Anti-Spyware 7.5\guard.exeC:\Program Files\Eset\nod32krn.exeC:\WINDOWS\system32\svc... Read more

A:Infected With Win32/psw.onlinegames.muu Trojan


Could you post a fresh hjt log?

Read other 2 answers











*F... Read more

A:Infected With Win32/psw.onlinegames.muu Trojan

My system is infected with Win32/PSW.OnLineGames.MUU trojan in file C:\WINDOWS\system32\amvo.exe (infected file)
I am unable to set my windowsExplorer options to "show hidden files and folders" and a file named Autorun.inf is there in every partition/drive...in the root directory. The problem was found while using Microsoft Internet Explorer 6.0
This was detected by my Antivirus, "NOD32 v2.0" I dont know from where it came from...as I am a knowledgeable person and i scan every file on www.virustotal.com Every file that I download.
I scanned my system with Nod32, AVG Anti-spyware, Ad-aware2007, Spyware Doctor. They found some threats, i removed them, after that i rebooted my system, scanned again, the viruses were found again. WHAT SHLD I DO...PLZ HELP ME"

Read other 1 answers

hello. sorry about this mess. im afraid i dont really know what im doing. my nephew asked me to help get rid of a red circle with a white cross telling him he had spyware but its turned into something much worse. he only used windows firewall and nothing else saying he only uses world of warcraft and msn and music and doesnt surf the web!! i tried to scan with avg but it was aborted and the windows firewall was continually turned off no matter how many times i put it on. tried other antivirus progs but all were turned off. eventually i managed to do online scan on microsoft safety centre and deleted quite a few v high threat trojans but many unable to clean. i also ran sophos rootkit and nearly gave myself a heart attack - 938 hidden things that recommend not to clean. i resorted to you now. i followed the tutorial for posting hijack this and here are the resultskaspersky report for critical areas--------------------------------------------------------------------------------KASPERSKY ONLINE SCANNER 7 REPORT Saturday, November 29, 2008 Operating System: Microsoft Windows XP Professional Service Pack 3 (build 2600) Kaspersky Online Scanner 7 version: Program database last update: Saturday, November 29, 2008 12:40:36 Records in database: 1426420--------------------------------------------------------------------------------Scan settings: Scan using the following database: extended Scan archives: yes Scan mail databases: yesScan area - Critical Areas: C:\Do... Read more

A:win32/alureon.gen, win32/Eldycow.en!A, win32/Small, win32/Olmafik, winNT/Xantvi.gen!A, Trojan-Game Thief and more

i think i have sorted this. i ran SDFix which cleaned up enough for me to install antivirus. avast caught lots of trojans and i have now been able to onlinescan and spybot s/d etc. all logs now coming back clean so can u delete this post please

Read other 3 answers

in need of help, antivirus wont remove it...

A:Trojan-Dropper.Win32.Agent.aum HOW DO I GET RID OF THIS?!?!

Please do not start more than one thread for the same topic.

Closing duplicate.

Please continue here:


Read other 1 answers