Over 1 million tech questions and answers.

Infected with Win32:Malware-gen, Win32:Rootkit-gen, and Win32:Spyware-gen

Q: Infected with Win32:Malware-gen, Win32:Rootkit-gen, and Win32:Spyware-gen

Firefox and Mostly IE is experiencing redirects when I search through any search engine. Avast is continuously stopping malware in the Windows\Temp folder.

DDS (Ver_09-12-01.01) - NTFSx86
Run by Ricardo at 15:09:36.31 on Sun 12/27/2009
Internet Explorer: 7.0.5730.13 BrowserJavaVersion: 1.6.0_17
Microsoft Windows XP Home Edition 5.1.2600.3.1252.1.1033.18.3071.2184 [GMT -8:00]

AV: avast! antivirus 4.8.1368 [VPS 091227-1] *On-access scanning enabled* (Updated) {7591DB91-41F0-48A3-B128-1A293FD8233D}
FW: McAfee Personal Firewall *enabled* {94894B63-8C7F-4050-BDA4-813CA00DA3E8}

============== Running Processes ===============

C:\WINDOWS\system32\svchost -k DcomLaunch
C:\WINDOWS\System32\svchost.exe -k netsvcs
C:\WINDOWS\system32\svchost.exe -k WudfServiceGroup
C:\Program Files\Alwil Software\Avast4\aswUpdSv.exe
C:\Program Files\Alwil Software\Avast4\ashServ.exe
C:\Program Files\Creative\Shared Files\CTAudSvc.exe
C:\Program Files\Common Files\Acronis\Schedule2\schedul2.exe
C:\Program Files\Common Files\Apple\Mobile Device Support\bin\AppleMobileDeviceService.exe
C:\Program Files\Java\jre6\bin\jqs.exe
C:\Program Files\Google\Update\GoogleUpdate.exe
C:\Program Files\LogMeIn\x86\RaMaint.exe
C:\Program Files\LogMeIn\x86\LogMeIn.exe
C:\Program Files\LogMeIn\x86\LMIGuardian.exe
C:\Program Files\McAfee\MPF\MPFSrv.exe
C:\Program Files\Sandboxie\SbieSvc.exe
C:\WINDOWS\system32\svchost.exe -k imgsvc
C:\Program Files\UPHClean\uphclean.exe
C:\Program Files\Alwil Software\Avast4\ashMaiSv.exe
C:\Program Files\Alwil Software\Avast4\ashWebSv.exe
C:\Program Files\LogMeIn\x86\LogMeInSystray.exe
C:\Program Files\Common Files\Acronis\Schedule2\schedhlp.exe
C:\Program Files\Creative\Shared Files\Module Loader\DLLML.exe
C:\Program Files\Creative\Sound Blaster X-Fi\Volume Panel\VolPanlu.exe
C:\Program Files\Acronis\TrueImageHome\TrueImageMonitor.exe
C:\Program Files\Acronis\TrueImageHome\TimounterMonitor.exe
C:\Program Files\Java\jre6\bin\jusched.exe
C:\Program Files\Sandboxie\SbieCtrl.exe
C:\Program Files\SUPERAntiSpyware\SUPERAntiSpyware.exe
C:\Program Files\LogMeIn\x86\LMIGuardian.exe
C:\Program Files\Evernote\Evernote3\Evernote.exe
C:\Program Files\Evernote\Evernote3\EvernoteTray.exe
C:\Program Files\Mozilla Firefox\firefox.exe
C:\Documents and Settings\Ricardo\My Documents\= Software =\- Tech Tools -\Anti Malware\HiJackThis.exe
C:\Program Files\Alwil Software\Avast4\setup\avast.setup
C:\Documents and Settings\Ricardo\Desktop\dds.scr

============== Pseudo HJT Report ===============

uStart Page = hxxp://www.google.com/
uInternet Settings,ProxyOverride = *.local
uRun: [SandboxieControl] "c:\program files\sandboxie\SbieCtrl.exe"
uRun: [SUPERAntiSpyware] c:\program files\superantispyware\SUPERAntiSpyware.exe
mRun: [LogMeIn GUI] "c:\program files\logmein\x86\LogMeInSystray.exe"
mRun: [Acronis Scheduler2 Service] "c:\program files\common files\acronis\schedule2\schedhlp.exe"
mRun: [AudioDrvEmulator] "c:\program files\creative\shared files\module loader\dllml.exe" -1 audiodrvemulator "c:\program files\creative\shared files\module loader\audio emulator\AudDrvEm.dll"
mRun: [VolPanel] "c:\program files\creative\sound blaster x-fi\volume panel\VolPanlu.exe" /r
mRun: [mcagent_exe] "c:\program files\mcafee.com\agent\mcagent.exe" /runkey
mRun: [NvCplDaemon] RUNDLL32.EXE c:\windows\system32\NvCpl.dll,NvStartup
mRun: [nwiz] nwiz.exe /install
mRun: [NvMediaCenter] RUNDLL32.EXE c:\windows\system32\NvMcTray.dll,NvTaskbarInit
mRun: [avast!] c:\progra~1\alwils~1\avast4\ashDisp.exe
mRun: [TrueImageMonitor.exe] c:\program files\acronis\trueimagehome\TrueImageMonitor.exe
mRun: [AcronisTimounterMonitor] c:\program files\acronis\trueimagehome\TimounterMonitor.exe
mRun: [SunJavaUpdateSched] "c:\program files\java\jre6\bin\jusched.exe"
IE: {e2e2dd38-d088-4134-82b7-f2ba38496583} - %windir%\Network Diagnostic\xpnetdiag.exe
IE: {92780B25-18CC-41C8-B9BE-3C9C571A8263} - {FF059E31-CC5A-4E2E-BF3B-96E929D65503} - c:\progra~1\micros~4\office11\REFIEBAR.DLL
IE: {E0B8C461-F8FB-49b4-8373-FE32E9252800} - {BC0E0A5D-AB5A-4fa4-A5FA-280E1D58EEE1} - c:\program files\evernote\evernote3\enbar.dll
Trusted Zone: netflix.com\www
DPF: {8AD9C840-044E-11D1-B3E9-00805F499D93} - hxxp://java.sun.com/update/1.6.0/jinstall-1_6_0_17-windows-i586.cab
DPF: {CAFEEFAC-0016-0000-0007-ABCDEFFEDCBA} - hxxp://java.sun.com/update/1.6.0/jinstall-1_6_0_07-windows-i586.cab
DPF: {CAFEEFAC-0016-0000-0017-ABCDEFFEDCBA} - hxxp://java.sun.com/update/1.6.0/jinstall-1_6_0_17-windows-i586.cab
DPF: {CAFEEFAC-FFFF-FFFF-FFFF-ABCDEFFEDCBA} - hxxp://java.sun.com/update/1.6.0/jinstall-1_6_0_17-windows-i586.cab
DPF: {E06E2E99-0AA1-11D4-ABA6-0060082AA75C} -
DPF: {F6ACF75C-C32C-447B-9BEF-46B766368D29} - hxxp://ccfiles.creative.com/Web/softwareupdate/su2/ocx/15108/CTPID.cab
DPF: {FD0B6769-6490-4A91-AA0A-B5AE0DC75AC9} - hxxps://secure.logmein.com/activex/ractrl.cab?lmi=100
Handler: intu-help-qb2 - {84D77A00-41B5-4b8b-8ADF-86486D72E749} - c:\program files\intuit\quickbooks 2009\HelpAsyncPluggableProtocol.dll
Handler: qbwc - {FC598A64-626C-4447-85B8-53150405FD57} - c:\windows\system32\mscoree.dll
Handler: skype4com - {FFC8B962-9B40-4DFF-9458-1830C7DD7F5D} - c:\progra~1\common~1\skype\SKYPE4~1.DLL
Notify: !SASWinLogon - c:\program files\superantispyware\SASWINLO.DLL
Notify: LMIinit - LMIinit.dll
SSODL: WPDShServiceObj - {AAA288BA-9A4C-45B0-95D7-94D524869DB5} - c:\windows\system32\WPDShServiceObj.dll
SEH: SABShellExecuteHook Class: {5ae067d3-9afb-48e0-853a-ebb7f4a000da} - c:\program files\superantispyware\SASSEH.DLL

================= FIREFOX ===================

FF - ProfilePath - c:\docume~1\ricardo\applic~1\mozilla\firefox\profiles\h2u4mn3q.default\
FF - prefs.js: browser.startup.homepage - hxxp://www.google.com/
FF - component: c:\documents and settings\ricardo\application data\mozilla\firefox\profiles\h2u4mn3q.default\extensions\{22119944-ed35-4ab1-910b-e619ea06a115}\components\rfproxy_31.dll
FF - component: c:\documents and settings\ricardo\application data\mozilla\firefox\profiles\h2u4mn3q.default\extensions\[email protected]\components\nsTwitterFoxSign.dll
FF - plugin: c:\documents and settings\ricardo\application data\mozilla\firefox\profiles\h2u4mn3q.default\extensions\[email protected]\plugins\npRACtrl.dll
FF - plugin: c:\documents and settings\ricardo\application data\mozilla\plugins\npgoogletalk.dll
FF - plugin: c:\documents and settings\ricardo\local settings\application data\google\update\\npGoogleOneClick7.dll
FF - plugin: c:\program files\divx\divx plus web player\npdivx32.dll
FF - plugin: c:\program files\google\update\\npGoogleOneClick8.dll
FF - HiddenExtension: Microsoft .NET Framework Assistant: {20a82645-c095-46ed-80e3-08825760534b} - c:\windows\microsoft.net\framework\v3.5\windows presentation foundation\dotnetassistantextension\
FF - HiddenExtension: Java Console: No Registry Reference - c:\program files\mozilla firefox\extensions\{CAFEEFAC-0016-0000-0003-ABCDEFFEDCBA}
FF - HiddenExtension: Java Console: No Registry Reference - c:\program files\mozilla firefox\extensions\{CAFEEFAC-0016-0000-0007-ABCDEFFEDCBA}
FF - HiddenExtension: Java Console: No Registry Reference - c:\program files\mozilla firefox\extensions\{CAFEEFAC-0016-0000-0011-ABCDEFFEDCBA}
FF - HiddenExtension: Java Console: No Registry Reference - c:\program files\mozilla firefox\extensions\{CAFEEFAC-0016-0000-0015-ABCDEFFEDCBA}
FF - HiddenExtension: Java Console: No Registry Reference - c:\program files\mozilla firefox\extensions\{CAFEEFAC-0016-0000-0017-ABCDEFFEDCBA}

c:\program files\mozilla firefox\greprefs\security-prefs.js - pref("security.ssl3.rsa_seed_sha", true);

============= SERVICES / DRIVERS ===============

R1 aswSP;avast! Self Protection;c:\windows\system32\drivers\aswSP.sys [2009-12-12 114768]
R1 SASDIFSV;SASDIFSV;c:\program files\superantispyware\SASDIFSV.SYS [2009-2-17 9968]
R2 aswFsBlk;aswFsBlk;c:\windows\system32\drivers\aswFsBlk.sys [2009-12-12 20560]
R2 avast! Antivirus;avast! Antivirus;c:\program files\alwil software\avast4\ashServ.exe [2009-12-12 138680]
R2 CAMTHWDM;WebcamMax, WDM Video Capture;c:\windows\system32\drivers\CAMTHWDM.sys [2009-1-25 941784]
R2 LMIInfo;LogMeIn Kernel Information Provider;c:\program files\logmein\x86\rainfo.sys [2008-7-24 12856]
R2 LMIRfsDriver;LogMeIn Remote File System Driver;c:\windows\system32\drivers\LMIRfsDriver.sys [2009-1-23 47640]
R3 avast! Mail Scanner;avast! Mail Scanner;c:\program files\alwil software\avast4\ashMaiSv.exe [2009-12-12 254040]
R3 avast! Web Scanner;avast! Web Scanner;c:\program files\alwil software\avast4\ashWebSv.exe [2009-12-12 352920]
R3 CT20XUT.SYS;CT20XUT.SYS;c:\windows\system32\drivers\CT20XUT.sys [2009-6-4 171032]
R3 CTEXFIFX.SYS;CTEXFIFX.SYS;c:\windows\system32\drivers\CTEXFIFX.sys [2009-6-4 1324056]
R3 CTHWIUT.SYS;CTHWIUT.SYS;c:\windows\system32\drivers\CTHWIUT.sys [2009-6-4 72728]
R3 radpms;Driver for RADPMS Device;c:\windows\system32\drivers\radpms.sys [2008-7-24 12192]
R3 SbieDrv;SbieDrv;c:\program files\sandboxie\SbieDrv.sys [2009-9-30 116736]
S1 SASKUTIL;SASKUTIL;\??\c:\docume~1\ricardo\locals~1\temp\sas_selfextract\saskutil.sys --> c:\docume~1\ricardo\locals~1\temp\sas_selfextract\SASKUTIL.sys [?]
S2 gupdate;Google Update Service (gupdate);c:\program files\google\update\GoogleUpdate.exe [2009-12-12 133104]
S2 vnccom;vnccom;c:\windows\system32\drivers\vnccom.SYS [2009-2-27 6016]
S3 Creative Audio Engine Licensing Service;Creative Audio Engine Licensing Service;c:\program files\common files\creative labs shared\service\CTAELicensing.exe [2009-6-27 79360]
S3 CT20XUT;CT20XUT;c:\windows\system32\drivers\CT20XUT.sys [2009-6-4 171032]
S3 CTEXFIFX;CTEXFIFX;c:\windows\system32\drivers\CTEXFIFX.sys [2009-6-4 1324056]
S3 CTHWIUT;CTHWIUT;c:\windows\system32\drivers\CTHWIUT.sys [2009-6-4 72728]
S3 epmntdrv;epmntdrv;c:\windows\system32\epmntdrv.sys [2009-12-13 8704]
S3 EuGdiDrv;EuGdiDrv;c:\windows\system32\EuGdiDrv.sys [2009-12-13 3072]
S3 ManyCam;ManyCam Virtual Webcam, WDM Video Capture Driver;c:\windows\system32\drivers\manycam.sys --> c:\windows\system32\drivers\ManyCam.sys [?]
S3 NUVision;NUVision II Video Service;c:\windows\system32\drivers\nuvvid2.sys [2009-1-23 153760]
S3 SASENUM;SASENUM;\??\c:\docume~1\ricardo\locals~1\temp\sas_selfextract\sasenum.sys --> c:\docume~1\ricardo\locals~1\temp\sas_selfextract\SASENUM.SYS [?]
S3 teamviewervpn;TeamViewer VPN Adapter;c:\windows\system32\drivers\teamviewervpn.sys [2008-1-25 25088]
S3 VBoxNetAdp;VirtualBox Host-Only Ethernet Adapter;c:\windows\system32\drivers\VBoxNetAdp.sys [2009-7-5 79888]
S3 VBoxNetFlt;VBoxNetFlt Service;c:\windows\system32\drivers\vboxnetflt.sys --> c:\windows\system32\drivers\VBoxNetFlt.sys [?]
S4 LMIRfsClientNP;LMIRfsClientNP; [x]

=============== Created Last 30 ================

2009-12-27 21:32:35 0 d-----w- c:\windows\ERUNT
2009-12-27 21:25:48 0 d-----w- C:\SDFix
2009-12-27 18:14:14 0 d-----w- c:\program files\SUPERAntiSpyware
2009-12-27 18:06:12 0 d-sh--w- c:\docume~1\ricardo\applic~1\.#
2009-12-26 19:15:42 3554 ----a-w- c:\windows\system32\tmp.reg
2009-12-26 18:32:15 0 d-----w- c:\program files\SpywareBlaster
2009-12-26 08:49:39 0 d-sha-r- C:\cmdcons
2009-12-26 08:46:40 98816 ----a-w- c:\windows\sed.exe
2009-12-26 08:46:40 77312 ----a-w- c:\windows\MBR.exe
2009-12-26 08:46:40 261632 ----a-w- c:\windows\PEV.exe
2009-12-26 08:46:40 161792 ----a-w- c:\windows\SWREG.exe
2009-12-26 08:41:37 389120 ----a-w- c:\windows\system32\CF19689.exe
2009-12-24 19:59:41 0 d-----w- c:\docume~1\ricardo\applic~1\GlarySoft
2009-12-24 19:36:59 0 d-----w- c:\program files\Glary Utilities
2009-12-21 07:21:15 0 d-----w- c:\docume~1\ricardo\applic~1\Command & Conquer 3 Tiberium Wars
2009-12-21 07:05:13 108144 ----a-w- c:\windows\system32\CmdLineExt.dll
2009-12-21 06:57:31 98304 ----a-w- c:\windows\system32CmdLineExt.dll
2009-12-21 06:37:04 334792 ----a-w- c:\windows\system32\_AxShlEx.dll
2009-12-21 06:36:35 0 d-----w- c:\program files\Alcohol Soft
2009-12-21 06:28:57 716272 ----a-w- c:\windows\system32\drivers\sptd.sys
2009-12-21 01:35:12 1096 ----a-w- c:\windows\boobbutton.bmp
2009-12-21 01:20:15 1033728 ----a-w- c:\windows\explorer.bak
2009-12-20 21:46:02 3 ----a-w- c:\windows\system32\msqctp.ini
2009-12-20 21:46:02 0 d-----w- c:\docume~1\ricardo\applic~1\Fronoh
2009-12-20 21:45:58 2912256 ----a-w- c:\windows\system32\MediaInfo.dll
2009-12-20 21:45:58 0 d-----w- c:\program files\MP3 & MPEG Joiner
2009-12-20 20:22:46 0 d-----w- c:\docume~1\ricardo\applic~1\Sedna Wireless
2009-12-20 20:22:29 0 d-----w- c:\program files\Call Graph
2009-12-20 20:22:29 0 d-----w- c:\docume~1\ricardo\applic~1\Call Graph
2009-12-20 18:38:33 0 d-----r- C:\Sandbox
2009-12-20 18:36:53 1464 ----a-w- c:\windows\Sandboxie.ini
2009-12-20 18:36:18 0 d-----w- c:\program files\Sandboxie
2009-12-18 21:02:02 0 d-----w- c:\program files\WinDirStat
2009-12-16 04:55:54 540000 ----a-w- c:\windows\system32\drivers\timntr.sys
2009-12-07 02:43:13 0 d-----w- c:\program files\common files\supportsoft
2009-12-07 02:35:11 0 d-----w- c:\program files\Intuit
2009-12-07 02:29:42 90 ----a-w- c:\windows\QBChanUtil_Trigger.ini
2009-12-07 02:29:42 0 d-----w- c:\docume~1\alluse~1\applic~1\SQL Anywhere 10
2009-12-07 02:29:36 0 d-----w- c:\docume~1\alluse~1\applic~1\COMMON FILES
2009-12-01 18:05:31 3247 ----a-w- c:\windows\system32\wbem\Outlook_01ca72b0deccba50.mof

==================== Find3M ====================

2009-12-26 09:35:42 45568 ----a-w- c:\windows\system32\drivers\SiSRaid.sys
2009-12-23 07:17:20 971552 ----a-w- c:\windows\system32\drivers\tdrpm174.sys
2009-12-23 07:17:13 44704 ----a-w- c:\windows\system32\drivers\tifsfilt.sys
2009-12-04 00:14:06 38224 ----a-w- c:\windows\system32\drivers\mbamswissarmy.sys
2009-12-04 00:13:56 19160 ----a-w- c:\windows\system32\drivers\mbam.sys
2009-11-23 06:32:33 37004 ---ha-w- c:\windows\system32\mlfcache.dat
2009-11-14 00:47:28 856064 ----a-w- c:\windows\system32\divx_xx0c.dll
2009-11-14 00:47:28 856064 ----a-w- c:\windows\system32\divx_xx07.dll
2009-11-14 00:47:28 847872 ----a-w- c:\windows\system32\divx_xx0a.dll
2009-11-14 00:47:28 843776 ----a-w- c:\windows\system32\divx_xx16.dll
2009-11-14 00:47:28 839680 ----a-w- c:\windows\system32\divx_xx11.dll
2009-11-14 00:47:28 696320 ----a-w- c:\windows\system32\DivX.dll
2009-11-03 03:29:16 1984 ----a-w- c:\windows\system32\d3d9caps.dat
2009-10-29 07:46:59 832512 ------w- c:\windows\system32\wininet.dll
2009-10-29 07:46:52 78336 ----a-w- c:\windows\system32\ieencode.dll
2009-10-29 07:46:50 17408 ------w- c:\windows\system32\corpol.dll
2009-10-21 05:38:36 75776 ----a-w- c:\windows\system32\strmfilt.dll
2009-10-21 05:38:36 25088 ----a-w- c:\windows\system32\httpapi.dll
2009-10-19 02:22:08 189392 ----a-w- c:\windows\system32\PnkBstrB.exe
2009-10-13 10:30:16 270336 ----a-w- c:\windows\system32\oakley.dll
2009-10-12 13:38:19 149504 ----a-w- c:\windows\system32\rastls.dll
2009-10-12 13:38:18 79872 ----a-w- c:\windows\system32\raschap.dll
2009-10-11 12:17:27 411368 ----a-w- c:\windows\system32\deploytk.dll
2009-10-02 00:42:49 83288 ----a-w- c:\windows\system32\LMIRfsClientNP.dll
2009-10-02 00:42:48 87352 ----a-w- c:\windows\system32\LMIinit.dll
2009-10-02 00:42:48 28984 ----a-w- c:\windows\system32\LMIport.dll

============= FINISH: 15:11:16.54 ===============

Preferred Solution: Infected with Win32:Malware-gen, Win32:Rootkit-gen, and Win32:Spyware-gen

I recommend downloading and running DAP. It can help sort out any driver and firmware related issues on your system

It's worked out well for many of us in the past.

You can download it direct from this link http://downloaddap.org. (This link will open the download page of DAP so you can save a copy to your computer.)

A: Infected with Win32:Malware-gen, Win32:Rootkit-gen, and Win32:Spyware-gen

Please close this post. I'm reformatting and reinstalling an Acronis Image prior to the infection. Thanks anyway.

Read other 2 answers

My Avast antivirus recently started detecting a whole host of viruses. I ran a thorough scan of all files and deleted every infected file until the scanner turned up a hit in the operating memory. It then suggested I run a boot sector scan - I did so. Upon rebooting Avast started detecting more viruses. This time I rebooted into Safe Mode and ran the scanner there, deleting everything I found. Apparently one of the files I deleted was important, because after that my computer Blue-Screened during boot-up and I had to do a system restore to a save point from a few days ago (before the virus was contracted). Since then the virus has continued to crop up, and I haven't the foggiest notion of how to get rid of it.

The title is a list of the virus descriptions that my Avast scanner gave me. I ran all the programs the walkthrough on this site instructed me to, but the RootRepeal program crashed and generated an error message and crash report, both attached (error message in .png image format - I took a screenshot of it).

Thanks for your help!

DDS (Ver_09-12-01.01) - NTFSx86
Run by Bryan at 18:56:06.09 on Wed 12/02/2009
Internet Explorer: 8.0.7600.16385 BrowserJavaVersion: 1.6.0_17
Microsoft Windows 7 Home Premium 6.1.7600.0.1252.1.1033.18.3070.1546 [GMT -5:00]
============== Running Processes ===============

C:\Windows\system32&... Read more

A:Infected with js: downloader-FT Win32:Banload-GLR Win32:Malware-gen Win32:Refpron-AW Win32:Rootkit-gen Win32:VB-NWC

Hello and welcome to Bleeping ComputerWe apologize for the delay in responding to your request for help. Here at Bleeping Computer we get overwhelmed at times, and we are trying our best to keep up. Please note that your topic was not intentionally overlooked. Our mission is to help everyone in need, but sometimes it takes just a little longer to get to every request for help. No one is ignored here.If you have since resolved the original problem you were having, we would appreciate you letting us know. If not please perform the following steps below so we can have a look at the current condition of your machine. If you have not done so, include a clear description of the problems you're having, along with any steps you may have performed so far.Upon completing the steps below another staff member will review and take the steps necessary with you to get your machine back in working order clean and free of malware.If you have already posted a DDS log, please do so again, as your situation may have changed.Use the 'Add Reply' and add the new log to this thread.Thanks and again sorry for the delay.We need to see some information about what is happening in your machine. Please perform the following scan:Download DDS by sUBs from one of the following links. Save it to your desktop.DDS.scrDDS.pifDouble click on the DDS icon, allow it to run.A small box will open, with an explaination about the tool. No input is needed, the scan is running.Notepad will open with the results.Foll... Read more

Read other 3 answers

Hi,Please help me in getting rid of the pop ups which keep coming up.trojan downloader win32 agent bqtrojan clicker win32 tiny htrojan spy win32 key logger.aatrojan spy win32 green screentrojan spy html bankfraud.dqHijakThis log file.Logfile of Trend Micro HijackThis v2.0.2Scan saved at 15:00:40, on 9/8/2008Platform: Windows XP SP2 (WinNT 5.01.2600)MSIE: Internet Explorer v7.00 (7.00.6000.16705)Boot mode: NormalRunning processes:C:\WINDOWS\System32\smss.exeC:\WINDOWS\system32\csrss.exeC:\WINDOWS\system32\winlogon.exeC:\WINDOWS\system32\services.exeC:\WINDOWS\system32\lsass.exeC:\WINDOWS\system32\svchost.exeC:\WINDOWS\system32\svchost.exeC:\WINDOWS\System32\svchost.exeC:\WINDOWS\system32\svchost.exeC:\WINDOWS\system32\svchost.exeC:\Program Files\Common Files\Symantec Shared\ccProxy.exeC:\Program Files\Common Files\Symantec Shared\ccSetMgr.exeC:\Program Files\Symantec Client Security\Symantec Client Firewall\ISSVC.exeC:\Program Files\Common Files\Symantec Shared\SNDSrvc.exeC:\Program Files\Common Files\Symantec Shared\SPBBC\SPBBCSvc.exeC:\Program Files\Common Files\Symantec Shared\ccEvtMgr.exeC:\WINDOWS\system32\spoolsv.exeC:\WINDOWS\Explorer.EXEC:\Program Files\Hewlett-Pac... Read more

A:Infected With Trojan Clicker Win32 Tiny.h / Downloader Win32 Agent Bq / Spy Win32 Key Logger.aa/spy Win32 Green Screen / Html B...

Sorry for the delay. If you are still having problems please post a brand new HijackThis log as a reply to this topic. Before posting the log, please make sure you follow all the steps found in this topic:Preparation Guide For Use Before Posting A Hijackthis LogPlease also post the problems you are having.

Read other 1 answers

Hello,My computer became infected last night, and It's pretty bad. I became infected with Infected: Trojan:Win32/Alureon.BT, Win32:Jifas-CY, and the others listed (maybe more). Long story short, I'd just watched Harry Potter on dvd, and logged onto the computer to see who he married in the end. I ended up at a Harry Potter encyclipdiea website, and looked it up. Avast went nuts after a few minutes, and showed 4 different virus alerts, and Windows Defender showed 1 as well after I shut down.The virus listed by Defender was Trojan:Win32/Alureon.BT. Avast listed Win32:Jifas-CY, I didn't get the others in time.The last 2 I listed in the title, a "security center alert" claimed it detected these programs trying to acess the internet. It listed one more, but I didn't get it's name in time.I know Alureon is a downloader and backdoor for other viruses, and it basically shuts down security systems, which it's trying to do since windows now thinks I have no anti-virus installed.All of these trojans are listed as "server" and "high risk." I'm not sure a root kit didn't try to make it's way in too.EDIT: I wanted to add a few things in. First, I have XP SP3 set up with multiple accouts, one admin "owner" account and then 1 limited access "user" account. The Viruses came in while the user account was logged on (I am not dumb enough to connect to the internet with an admin account). It seems the Viruses we... Read more

A:Infected: Trojan:Win32/Alureon.BT, Win32:Jifas-CY, Backdoor.Win32.Kbot.al, Net-Worm.Win32.Mytob.t

Hello again.I booted into Safe Mode and ran an Avast scan (which took forever) and it was a waste of time. The stupid thing found nothing wrong, and said the system was clean (which is the opposite it says when you log into the limited user account). The computer (and specially that account at least) is definitely infected. Could the viruses be hiding themselves when in safe mode?Should I scan from a Pre-install environment like BartPE? Or from the Regular "Owner" Admin account? I waited 2 days for the stupid program to scan 700gb (painfully slow for a qaud core, though to be excepted in safe mode), and it was useless.Other than running windows defender (which I'm doing now), and maybe trying MBAM, I'm not sure what to do. I'm not expect enough to dive into programs like OTViewIT and Combofix, so I'll need help here. Please, ANY HELP is appreciated. I would rather NOT wipe the drive and reinstall the whole system, but I need to get this figured out.Does no one have any ideas???

Read other 5 answers

Hello,Please help if you can .I ran free Avast! version 5.0.677 on my Windows XP desktop computer (Pentium 4, 1.5 Ghz CPU, 1 gb ram), and came up with the following virus warnings. Unfortunately the Avast! software internal tools to remove it are grayed out and not functioning. I tried a couple of things to remove viruses from help online and then realized I was in way over my head. I found this forum and am now requesting help.Avast! says I am affected with:JS:Downloader-AT, Win32:Nimda, Win32:Small-GWM, Win32:VB-EIJ, Win32:WinSpy-CK, JS:ScriptSH-inf, and Win32:VirutAttached a screen shot of Avast! with viruses and partial path to them. Computer's Symptoms (not sure if these are all due to old slow processor or malware):Computer is freezing often;When it is in sleep mode it is turning itself on;Seems to be downloading stuff often and slowing down;Monitor is going black forcing reboots often;Couple weeks back I began getting floating ads that pop up when browsing online;I get an error message daily that says AdAware has shut down unexpectedly, do I want to send a report? I have been ignoring this, not knowing if it was important, been several weeks.Ok, I think that is all I can think of to share. Please help if you can. I appreciate it.Thanks,Dancer~~~~~~~~~~DDS (Ver_10-03-17.01) - NTFSx86 Run by ljk at 15:52:28.93 on Mon 09/20/2010Internet Explorer: 6.0.2900.5512 BrowserJavaVersion: 1.6.0_18Microsoft Windows XP Professional 5.1.2600.3.1252.1.1033.18.102... Read more

A:Please Help ~ Infected with JS:Downloader-AT, Win32:Nimda, Win32:Small-GWM, Win32:VB-EIJ, Win32:WinSpy-CK, JS:ScriptSH-inf, and...

Hello, and to the Malware Removal forum! My online alias is Blade Zephon, or Blade for short, and I will be assisting you with your malware issues!In the upper right hand corner of the topic you will see a button called Options. If you click on this in the drop-down menu you can choose Track this topic. By doing this and then choosing Immediate E-Mail notification and then clicking on Proceed you will be advised when we respond to your topic and facilitate the cleaning of your machine.Before we begin cleaning your machine, I'd like to lay out some guidelines for us to follow while we are working together.I will be assisting you with your malware issues. This may or may not resolve other problems you are having with your computer. If you are still having problems after your machine has been determined clean, I will be glad to direct you to the proper forum for assistance.Even if things appear better, that does not mean we are finished. Please continue to follow my instructions until I give you the all clean. Absence of symptoms does not mean that all the malware has been removed. If a piece of the infection is left, it can regenerate and reinfect your machine. Attention to detail is important! Since I cannot see or directly interact with your computer I am dependent on you to "be my eyes" and provide as much information as you can regarding the current state of your computer.I ask that you please refrain from running tools other than those I su... Read more

Read other 42 answers

I believe I was infected last night when a website somehow redirected me to liteautogreatest{dot}cn.I'm running XP Home SP3 and the ZoneAlarm Internet Security Suite (just updated earlier today).ZoneAlarm continually finds a couple of problems and hibernates them but they do not go completely away after a reboot.The ZoneAlarm active monitor scan shows the following...Trojan-Dropper.Win32.Agent.amzh was found in C:\Documents and Settings\Don\Local Settings\Temp\BNB.tmp on 4/20/2009 13:29:22Trojan-Dropper.Win32.Agent.amzh was found in C:\Documents and Settings\Don\Local Settings\Temp\BNA.tmp on 4/20/2009 13:23:26Trojan-Dropper.Win32.Agent.amzh was found in C:\Documents and Settings\Don\Local Settings\Temp\BN9.tmp on 4/20/2009 13:17:40Trojan-Dropper.Win32.Agent.amzh was found in C:\Documents and Settings\Don\Local Settings\Temp\BN8.tmp on 4/20/2009 13:14:30Trojan-Dropper.Win32.Agent.amzh was found in C:\Documents and Settings\Don\Local Settings\Temp\BN7.tmp on 4/20/2009 13:07:26Trojan-Dropper.Win32.Agent.amzh was found in C:\Documents and Settings\Don\Local Settings\Temp\BN6.tmp on 4/20/2009 13:02:40Rootkit.Win32.Agent.ikz was found in C:\WINDOWS\system32\drivers\systemntmi.sys on 4/20/2009 12:57:48Trojan-Dropper.Win32.Agent.amzh was found in C:\Documents and Settings\Don\Local Settings\T... Read more

A:Infected with Rootkit.Win32.Agent.ikz, Trojan-Dropper.Win32.Agent.amzh, Trojans? Malware?

Please download ATF Cleaner by Atribune & save it to your desktop. DO NOT use yet.alternate download linkThen download and install SUPERAntiSpyware FreeDouble-click SUPERAntiSypware.exe and use the default settings for installation.An icon will be created on your desktop. Double-click that icon to launch the program.If it will not start, go to Start > All Prgrams > SUPERAntiSpyware and click on Alternate Start.If asked to update the program definitions, click "Yes". If not, update the definitions before scanning by selecting "Check for Updates". (If you encounter any problems while downloading the updates, manually download them from here. Double-click on the hyperlink for Download Installer and save SASDEFINITIONS.EXE to your desktop. Then double-click on SASDEFINITIONS.EXE to install the definitions.)In the Main Menu, click the Preferences... button.Click the "General and Startup" tab, and under Start-up Options, make sure "Start SUPERAntiSpyware when Windows starts" box is unchecked.Click the "Scanning Control" tab, and under Scanner Options, make sure the following are checked (leave all others unchecked):Close browsers before scanning.Scan for tracking cookies.Terminate memory threats before quarantining.Click the "Close" button to leave the control center screen and exit the program.Do not run a scan just yet.Reboot your computer in "Safe Mode" using the F8 method. To do this, re... Read more

Read other 3 answers

Avast continually blocks the following threats: - Win32:Malware-gen - WIn32:Downloader-PKU [Trj] - Win32:DNSChanger-VJ [Trj]Avast scans and detects Win32:Sirefef-PL [Rtk], cannot remove it though.Malwarebytes scan detects BCminer, quarantines it, though never seems to get rid of BCminer. Other issues of possible note: - Windows Firewall not running 0x80070424 - Backup & Restore - last backup did not complete successfully - server execution failed - 0x80080005Ran both DDS and GMER (GMER did not have all the options available as per the preparation guide, and did not log anything when the scan was complete). .DDS (Ver_2011-08-26.01) - NTFSAMD64 Internet Explorer: 9.0.8112.16421Run by Family-pc at 12:37:05 on 2012-08-05Microsoft Windows 7 Home Premium 6.1.7601.1.1252.2.1033.18.16383.13888 [GMT -4:00].SP: Windows Defender *Disabled/Updated* {D68DDC3A-831F-4fae-9E44-DA132C1ACF46}.============== Running Processes ===============.C:\Windows\system32\wininit.exeC:\Windows\system32\lsm.exeC:\Windows\system32\svchost.exe -k DcomLaunchC:\Windows\system32\svchost.exe -k RPCSSC:\Windows\system32\atiesrxx.exeC:\Windows\System32\svchost.exe -k LocalServiceNetworkRestrictedC:\Windows\System32\svchost.exe -k LocalSystemNetworkRestrictedC:\Windows\system32\svchost.exe -k netsvcsC:\Windows\system32\svchost.exe -k LocalServiceC:\Windows\sy... Read more

A:Win32:Sirefef-PL, Win32:Malware-gen, WIn32:Downloader-PKU [Trj], Win32:DNSChanger-VJ [Trj], BCMiner need help

Hello Njals, Welcome to Bleeping Computer.
My name is fireman4it and I will be helping you with your Malware problem.

Please take note of some guidelines for this fix:
Refrain from making any changes to your computer including installing/uninstall programs, deleting files, modifying the registry, and running scanners or tools.
If you do not understand any step(s) provided, please do not hesitate to ask before continuing.
Even if things appear to be better, it might not mean we are finished. Please continue to follow my instructions and reply back until I give you the "all clean".
In the upper right hand corner of the topic you will see a button called Watch Topic.I suggest you click it and select Immediate E-Mail notification and click on Proceed. This way you will be advised when we respond to your topic and facilitate the cleaning of your machine.

Finally, please reply using the ADD REPLY button in the lower right hand corner of your screen. Do not start a new topic. The logs that you post should be pasted directly into the reply, unless they do not fit into the post.
I will be analyzing your log. I will get back to you with instructions.Do you have a USB Flash Drive you can use?

Read other 21 answers

Hello, Ive been fowarded from Bronis care(Security > Am I infected? What do I do? forum) as stated "...at this point some more advanced tools (not allowed in this forum) will be needed to clean up your computer.
With the information you have provided I believe you will need help from the malware removal team."

thread link

I dont know the name of the infection but Spybot found Win32.AVKillsvc.e which it keeps fixing & keeps showing back up.
AVG cannot be accessed or found but did just previously find Trojan Horse Backdoor.Generic.UFQ & Win32\Cryptor. There was also a popup of something like- "Microsoft Feeds Update needed" or something? and there was a message something like- "Windows is not your operating program"?

I couldnt connect to internet (wireless) but Broni seems to have sorted that out so now I am able to but GMER(which did fully scan with Broni, using UBB flash for download) now cuts out. I was able to stop & copy the scan before the cut point & will include that log which may be incomplete (see previous full scan log posted on previous thread) Other logs also posted on that thread may be helpful.
Thanks in advance for trying to get me through this part! Cat

Here is the DDS:

DDS (Ver_2011-08-26.01) - NTFSx86
Internet Explorer: 7.0.5730.13
Run by Owner at 23:27:46 on 2011-09-05
Microsoft Windows XP Home Edition 5.1.2600.2.1252.1.1033.18.95... Read more

A:fwd from Broni- nasty rootkit! Win32.AVKillsvc.e - Rootkit.Win32.ZAccess.e - Win32\Cryptor

Hello and Welcome to the forums! My name is Gringo and I'll be glad to help you with your computer problems. Somethings to remember while we are working together.Do not run any other tool untill instructed to do so!please Do not Attach logs or put in code boxes.Tell me about any problems that have occurred during the fix.Tell me of any other symptoms you may be having as these can help also.Do not run anything while running a fix.Do not run any other tool untill instructed to do so!Click on the Watch Topic Button and select Immediate Notification and click on proceed, this will help you to get notified faster when I have replied and make the cleaning process faster.Please print out or make a copy in notpad of any instructions given, as sometimes it is necessary to go offline and you will lose access to them.Run Combofix:You may be asked to install or update the Recovery Console (Win XP Only) if this happens please allow it to do so (you will need to be connected to the internet for this)Before you run Combofix I will need you to turn off any security software you have running, If you do not know how to do this you can find out >here< or >here<Combofix may need to reboot your computer more than once to do its job this is normal.You can download Combofix from one of these links.Link 1Link 2Link 3 1. Close any open browsers or any other programs that are open.2. Close/disable all anti virus and anti malware programs so they do not interfere with the r... Read more

Read other 43 answers

Hello, I was infected with a virus and didn't have any protection on my PC. I went out and bought Kaspersky Internet Security 2009. My original problem was that the virus was not allowing me to surf the internet with out popups and redirects. After running the Kaspersky software it cleaned up a bunch of issues but has gotten to a point were it cannot clean the last two issues. It recognizes them and marks them for deletion but asks me to reboot in order to delete. After I reboot it just finds the viruses again and I repeat the process endlessly.

I went through some troubleshooting steps with a Kaspersky rep and she decided that she had exhausted all options and asked me to format the computer. That is not an option and I don't believe that there is no hope of cleaning the virus. I am in need of someone with a little more expertise and vigilance.

The two issues are described below as listed by the Kaspersky software:
1. Trojan-Cliker.win32.delf.cbe - Object: C:\windows\system32\gznvqkei.dll
2. Rootkit.win32.Podnuha.a - Object: System Memory

When I try to manually delete the gznvqkei.dll file I get an "Access Denied" error.

The Kaspersky rep did have me run the combofix software but it did not solve the issue. She had me run a custom script from within the AV software that was designed to delete the troubled files to no avail. She also had me create a boot disk but when using the boot disk it does not recognize my hard drive so ... Read more

A:2 Infected - Rootkit.win32.Podnuha.a and Trojan-Cliker.win32.delf.cbe

Probably you best chance is to submit a HJT logPlease read the pinned topic titled "Preparation Guide For Use Before Posting A Hijackthis Log". If you cannot complete a step, then skip it and continue with the next. In Step 6 there are instructions for downloading and running DDS which will create a Pseudo HJT Report as part of its log.When you have done that, post your log in the HijackThis Logs and Malware Removal forum, NOT here, for assistance by the HJT Team Experts. A member of the Team will walk you through, step by step, on how to clean your computer. If you post your log back in this thread, the response from the HJT Team will be delayed because your post will have to be moved. This means it will fall in line behind any others posted that same day. Start a new topic, give it a relevant title and post your log along with a brief description of your problem, a summary of any anti-malware tools you have used and a summary of any steps that you have performed on your own. An expert will analyze your log and reply with instructions advising you what to fix. After doing this, we would appreciate if you post a link to your log back here so we know that your getting help from the HJT Team.Please be patient. It may take a while to get a response because the HJT Team members are very busy working logs posted before yours. They are volunteers who will help you out as soon as possible. Once you have made your post and are waiting, please DO NOT "bump" your post or make another r... Read more

Read other 3 answers

Hello, I was told to post here by the moderator. Here's the scoop: I was infected with a virus and didn't have any protection on my PC. I went out and bought Kaspersky Internet Security 2009. My original problem was that the virus was not allowing me to surf the internet with out popups and redirects. After running the Kaspersky software it cleaned up a bunch of issues but has gotten to a point were it cannot clean the last two issues. It recognizes them and marks them for deletion but asks me to reboot in order to delete. After I reboot it just finds the viruses again and I repeat the process endlessly.

I went through some troubleshooting steps with a Kaspersky rep and she decided that she had exhausted all options and asked me to format the computer. That is not an option and I don't believe that there is no hope of cleaning the virus. I am in need of someone with a little more expertise and vigilance.

The two issues are described below as listed by the Kaspersky software:
1. Trojan-Cliker.win32.delf.cbe - Object: C:\windows\system32\gznvqkei.dll
2. Rootkit.win32.Podnuha.a - Object: System Memory

When I try to manually delete the gznvqkei.dll file I get an "Access Denied" error.

The Kaspersky rep did have me run the combofix software but it did not solve the issue. She had me run a custom script from within the AV software that was designed to delete the troubled files to no avail. She also had me create a boot disk but when using the boot d... Read more

A:2 Infected - Rootkit.win32.Podnuha.a and Trojan-Cliker.win32.delf.cbe

Hello dmacc01.If you still have the same issues, you may consider the following. But first, be absolutely aware that having the system without an antivirus program is an extremely dangerous thing.Let's have you create a restore point (at this time). 1. Right click the My Computer icon on the Desktop and click on Properties.2. Click on the System Restore tab.3. If there is a check mark next to "Turn off System Restore on all drives", then click on the line to clear it.4. If C is your system drive (as it is in most cases) and you see other drives monitored in the list (like D, E, etc) click on the other drives, press Settings button, and get the other drives turned off.5. we only want to monitor the drive with Windows o.s.If you are unable to activate System Restore or if the service is disabled, then.....from the Start button > RUN option .... type in services.msclook for System Restore serviceIf it is listed as off or inactive, press on the link at top left to Start it.Next, See and do as outlined here http://bertk.mvps.org/html/createrp.htmlAfter that, also do this:1. Go >> Here << and download ERUNT (ERUNT (Emergency Recovery Utility NT) is a free program that allows you to keep a complete backup of your registry and restore it when needed.)2. Install ERUNT by following the prompts (use the default install settings but say no to the portion that asks you to add ERUNT to the start-up folder, if you like you can enable this option later)3. Start ERUNT... Read more

Read other 4 answers

OK- I am not extremely computer savvy... I may have destroyed the computer beyond repair, but my files are not backed up and all of the videos of my son when he was a baby are on there and only there. So, HELP!!!! I had a bad virus that started as pop ups for fake virus protection- I can't even remember what it said. I gave it to my brother in law to fix and it took him a month to tell me I needed to backup my files cause he was going to dump the whole thing. Last night after plugging in the USB and having it fill up without even getting through a 1/4 of our pictures, I decided to try to get rid of the virus myself. I ran malwarebytes which found some items and told me to shut down to complete. I did, got the blue screen- started in safe mode w/ networking (got a pop up that said malwarebytes could not be located). After some more searching, I downloaded Hitman that was made for the DNS virus- I know whatever it is on my computer is really bad. The local connection icon was completely removed. Ethernet driver gone and microsoft system tools like firewall and security all gone. Here is a what hitman said before it told me to reboot to complete the deletion of the virus (s). Rootkit rootkit.mbr.pihar.d (boot image) ,trojan.tdlphaze.1, rootkit.win32.pihar!Ik, Win32/bootkit, Malware gen:variant.graftor.13001 (engine A), backdoor.maxplus, trojan-dropper.win32.sirefeflIK... and 57 items in tempfiles..... HELP PLEASE!

A:. Rootkit rootkit.mbr.pihar.d (boot image) ,trojan.tdlphaze.1, rootkit.win32.pihar!Ik, Win32/bootkit, Malware gen:variant.g...

Copy this tool to the infected PC FSS Checkmark all the boxesClick on "Scan".Please copy and paste the log to your reply.

Read other 1 answers

I use ESET NOD32. At startup it detects the win32/Kryptik in a start-up scan and later mentions the Win32 rootkit running in memory. The scan log shows that it has detected this on each startup but it cannot delete because files are locked from removal. I have not been able to tell what file NOD is trying to find. Below is last log file post: This same message is repeated in numerous 10+ restarts in the past 24 hours.

5/19/2009 8:25:51 PM Startup scanner file \\?\globalroot\systemroot\system32\gxvxctxujtymqsiltimrpcilnqyirvmqgrlhk.dll a variant of Win32/Kryptik.PF trojan cleaned by deleting (after the next restart) - quarantined
5/19/2009 8:25:46 PM Startup scanner operating memory Operating memory Win32/Rootkit.Agent.ODG trojan unable to clean

I have run ESET in safe mode. It didnot do anything to eliminate the problem. Windows Defender has apparently not done anything either. Finally, I tried windows malicious software removal, but apparently it could not do anything either.

Main problem I notice is delays in internet usage. Happens both in firefox and ie. I changed DNS settings from automatically detect to a fixed DNS setting from earthlink.net. Still same slow down in internet usage.

Appreciate any help you can give. I have tried to find bad file, but to no avail.


DDS (Ver_09-05-14.01) - NTFSx86
Run by Pop at 21:38:42.70 on Tue 05/19/2009
Internet Explorer: 7.0.... Read more

A:Infected with Win32/Krptik.PF and win32/Rootkit.agent.odg.trojan

It now looks like I may have been able to repair my problem. I used a somewhat, haphazard, unguided approach to removal. The final solution came from AVG Rootkit removal ( http://download.cnet.com/AVG-Anti-Rootkit-...4-10662685.html ). Here is a list of all the steps I attempted. I was worried at times I could have hurt my system, but then I would have had to reinstall the OS. But, on the other hand, some internet posts I read were saying that was the only way to repair the situation. So, desperation took hold. I found my reinstall disks, just in case I needed them and proceeded. ATF Cleaner -- Who needs temp files anyway, especially if they might have trojans, I eliminated temp files this program would find.CC Cleaner - used this to clean out internet cache and history.Recycler folders - I had multiple recycler folders, one that had a rundll in it. I assumed you only have one recycle bin so you only need one of these folders. I had to reset the folder view options in exlorer to see all files and folders (hidden, system, etc.) I deleted the extra recycler folders I could find.System Restore - I turned off system restore. This would erase all the previous positions I had saved. This meant I could never go back to a prior position where my computer was running good, but I didn't know how to find out if I had virus/trojan in one of these saved files I then immediately turned back on the system restore after the old restore files were deleted.b]Windows defender[... Read more

Read other 2 answers

m ades, windows xp sp3
to whomever can help- i tried to remove some viruses
using info from bleeping, but am not having any luck.

i downloaded a file that i thought could help me on another
matter, but it had a virus that zone alarm's active scan did not

it was a rootkit virus. i tried tdsskiller several times as well as
malwarebytes, and thought i finally got rid of it. then another
virus popped up despite my not having connected to the internet.

another was this patch virus that kept redirecting my opera
browser. malwarebytes did not see this, but zone alarm did.
i tried to get rid of it and used tdsskiller, and thought i did.
i had to keep switching between safe mode and
normal mode to do it. i had no problems for two weeks, then
both seemed to pop up again. my guess is that i never
actually got rid of them. i tried zone alarm, malwarebytes,
and tdsskiller over and over again, with no luck. then my
ability to connect to the net went away. i gave up and restored
my hdd using the file i made just after i thought i had gotten
rid of the problems, so that though i would still have the viruses,
i would get back the net. using tdsskiller and malwarebytes
still did not work, and a new virus showed up. .

i'm including the logs from zone alarm, malwarebytes, and tdsskiller.

i would really appreciate help.

first to show up. used tdsskiller, seemed to be removed, kept showing back up.

(Forged): C:\WINDOWS\system32... Read more

A:infected with Rootkit.Win32.ZAccess.e, HiddenFile.Multi.Generic, Trojan.Win32.Patched.mf,, Backdoor.Agent.Gen) -> Value: Sh...

ps i have mbam, zone alarm,tdss,
and hijack logs, but was not sure
how to post them since the number
of text characters on this page
was limited.

Read other 70 answers

Hy there

My eset Nod 32 antivirus 4 detected Win32/Sirefef.CH & Win32/Rootkit.Agent.NUS
I tried to remove them with Kaspersky removal tool, Malwarebytes anti-malware, SPYBOT
All Failed to delete this file C:\WINDOWS\assembly\GAC_MSIL\desktop.ini wich is a Win32/Sirefef.CH trojan
The other Win32/Rootkit.Agent.NUS trojan is in operating memory
My pc symptoms are: 1. can't acces a direct link....i have to press 3-4 times the Enter Key in browser..then page will load.
2. Pc is moving slow

A:infected by Win32/Sirefef.CH & Win32/Rootkit.Agent.NUS

HiPlease do the following:Please download TDSSKiller.zipExtract it to your desktopDouble click TDSSKiller.exePress Start Scan
Only if Malicious objects are found then ensure Cure is selectedThen click Continue > Reboot nowCopy and paste the log in your next reply
A copy of the log will be saved automatically to the root of the drive (typically C:\)NEXTDownload ComboFix from one of the following locations:Link 1 Link 2 VERY IMPORTANT !!! Save ComboFix.exe to your Desktop * IMPORTANT - Disable your AntiVirus and AntiSpyware applications, usually via a right click on the System Tray icon. They may otherwise interfere with our tools. If you have difficulty properly disabling your protective programs, refer to this link here Double click on ComboFix.exe & follow the prompts.As part of it's process, ComboFix will check to see if the Microsoft Windows Recovery Console is installed. With malware infections being as they are today, it's strongly recommended to have this pre-installed on your machine before doing any malware removal. It will allow you to boot up into a special recovery/repair mode that will allow us to more easily help you should your computer have a problem after an attempted removal of malware.Follow the prompts to allow ComboFix to download and install the Microsoft Windows Recovery Console, and when prompted, agree to the End-User License Agreement to install the Microsoft Windows Recovery Console.**Please note: If the Microsoft Wind... Read more

Read other 14 answers

Hi, My laptop is running on Windows XP Home Edition Ver 2002 SP3. I also have CA Anti-virus software and Malwarebytes installed.

Recently, my laptop is infected by the malwares Win32/ZAcesss.AC, Win32/Karagany.ZAAE and Win32/Fosniw.ZABA. The CA Anti-virus software detected and quarantined them but it came back again after reboot. Also, Google search results are also redirected to the website xa.com.

I would be most grateful if you could help to solve this issue. The DDS log is pasted below. For your info, I received the following message when GMER completed scanning: WARNING!!! GMER has found system modification caused by ROOTKIT activity.
DDS (Ver_2011-08-26.01) - NTFSx86
Internet Explorer: 7.0.5730.11
Run by CST at 4:20:34 on 2011-11-25
Microsoft Windows XP Home Edition 5.1.2600.3.936.86.1033.18.2047.1291 [GMT 8:00]
AV: CA Anti-Virus Plus *Enabled/Updated* {6B98D35F-BB76-41C0-876B-A50645ED099A}
AV: PC Cleaners *Disabled/Updated* {737A8864-C2D9-4337-B49A-B5E35815B9BB}
============== Running Processes ===============
C:\WINDOWS\system32\svchost -k DcomLaunch
C:\Program Files\Windows Defender\MsMpEng.exe
C:\WINDOWS\System32\svchost.exe -k netsvcs
C:\WINDOWS\system32\svchost.exe -k WudfServiceGroup
C:\Program Files\Intel\Wireless\Bin\EvtEng.exe
C:\Program Files\Intel\Wireless\Bin\Zcfg... Read more

A:Google redirect to xa.com and malware Win32/ZAcesss.AC, Win32/Karagany.ZAAE and Win32/Fosniw.ZABA

Hi,Please do the following:Download ComboFix from one of the following locations:Link 1 Link 2 VERY IMPORTANT !!! Save ComboFix.exe to your Desktop * IMPORTANT - Disable your AntiVirus and AntiSpyware applications, usually via a right click on the System Tray icon. They may otherwise interfere with our tools. If you have difficulty properly disabling your protective programs, refer to this link here Double click on ComboFix.exe & follow the prompts.As part of it's process, ComboFix will check to see if the Microsoft Windows Recovery Console is installed. With malware infections being as they are today, it's strongly recommended to have this pre-installed on your machine before doing any malware removal. It will allow you to boot up into a special recovery/repair mode that will allow us to more easily help you should your computer have a problem after an attempted removal of malware.Follow the prompts to allow ComboFix to download and install the Microsoft Windows Recovery Console, and when prompted, agree to the End-User License Agreement to install the Microsoft Windows Recovery Console.**Please note: If the Microsoft Windows Recovery Console is already installed, ComboFix will continue it's malware removal procedures. Once the Microsoft Windows Recovery Console is installed using ComboFix, you should see the following message:Click on Yes, to continue scanning for malware.When finished, it shall produce a log for you. Please include the C:\C... Read more

Read other 16 answers

Hey Fellas,

First of all, bless you guys for volunteering your time to help the helpless masses :)
Second, I got hit with some nasty malware when I used a coworkers Flash Drive. Avast found Win32: Spyware-gen {Trj} and Win32: Rootkit-gen {Rtk}. All programs are timing out, windows explorer crashes, Firefox and IE time out even with a valid IP. This is a work computer, but I have administrator rights. I have posted my log below:

Thank you in advance!

Logfile of Trend Micro HijackThis v2.0.2
Scan saved at 13:54, on 2008-12-04
Platform: Windows XP SP3 (WinNT 5.01.2600)
MSIE: Internet Explorer v7.00 (7.00.6000.16705)
Boot mode: Normal

Running processes:
C:\Program Files\WIDCOMM\Bluetooth Software\bin\btwdins.exe
C:\Program Files\Alwil Software\Avast4\aswUpdSv.exe
C:\Program Files\Alwil Software\Avast4\ashServ.exe
C:\Program Files\Citrix\ICA Client\ssonsvr.exe
C:\Program Files\Hewlett-Packard\HP ProtectTools Security Manager\PTHOSTTR.EXE
C:\Program Files\Synaptics\SynTP\SynTPEnh.exe
C:\Program Files\Hewlett-Packard\HP Wireless Assistant\HPWA... Read more

A:Infection: win32:spyware-gen [trj] and win32:Rootkit-gen [rtk]

I scanned my computer with SDFix, here is the resulting log:

SDFix: Version 1.240
Run by installation on 2008-12-04 at 02:39

Microsoft Windows XP [Version 5.1.2600]
Running From: C:\SDFix

Checking Services :

Restoring Default Security Values
Restoring Default Hosts File


Checking Files :

Trojan Files Found:

C:\WINDOWS\system32\i - Deleted

Removing Temp Files

ADS Check :

Final Check :

catchme 0.3.1361.2 W2K/XP/Vista - rootkit/stealth malware detector by Gmer, http://www.gmer.net
Rootkit scan 2008-12-04 0314
Windows 5.1.2600 Service Pack 3 NTFS

scanning hidden processes ...

scanning hidden services & system hive ...

scanning hidden registry entries ...

[HKEY_LOCAL_MACHINE\SOFTWARE\Microsoft\Windows NT\CurrentVersion\Windows]

scanning hidden files ...

scan completed successfully
hidden processes: 0
hidden services: 0
hidden files: 0

Remaining Services :

Authorized Application Key Export:

[HKEY_LOCAL_MACHINE\system\currentcontrolset\services\sharedaccess\parameters\firewallpolicy\standardprofile\authorizedapplicat... Read more

Read other 7 answers

Hey I could use some help getting rid of this virus, I think Ramnit-A might be around too on it. I've done some researching trying to see if I could try and fix this on my own, but I think this might go quicker.I have spybot and adaware (freeware) on my computer, spybot hasn't bothered to pick anything up in this mess. Adaware has picked up Ramnit-A virus on the system and it always ends up with a list of items to repair (mostly files and a few processes at the end of the list), a cookie, and then ~4 misc. items that it recommends the "just once option". Anyways it hasn't been working, so from my reading, from a topic I managed to google from this forum board I downloaded Avast, which has grabbed virus file types that I listed in the topic with quick scan (and with it's "shields" too) . The other disturbing thing is that I think I have about 3000+ files now sitting in my virus chest on Avast from running the thing...safe to probably say it's not fixing anything.I'm a little worried too about the fact that the files Avast is taking are, or were just regular exe's some that were actually on my desktop. Has left me wondering if I should delete everything in the virus chest or not, I'm not going to end up deleting something important if I do? (main worry)From what I've read I hope I posted the required stuff, I'm currently running Gmer right now, I'll probably leave it running and try posting it tomorrow morning as ... Read more


Hello and welcome to Bleeping ComputerWe apologize for the delay in responding to your request for help. Here at Bleeping Computer we get overwhelmed at times, and we are trying our best to keep up. Please note that your topic was not intentionally overlooked. Our mission is to help everyone in need, but sometimes it takes just a little longer to get to every request for help. No one is ignored here.If you have since resolved the original problem you were having, we would appreciate you letting us know. If not please perform the following steps below so we can have a look at the current condition of your machine. Please include a clear description of the problems you're having, along with any steps you may have performed so far.Please refrain from running tools or applying updates other than those we suggest while we are cleaning up your computer. The reason for this is so we know what is going on with the machine at any time. Some programs can interfere with others and hamper the recovery process.Even if you have already provided information about your PC, we need a new log to see what has changed since you originally posted your problem.We need to create an OTL ReportPlease download OTL from one of the following mirrors:This is THE MirrorSave it to your desktop.Double click on the icon on your desktop.Click the "Scan All Users" checkbox.In the custom scan box paste the following:CODEmsconfigsafebootminimalactivexdrivers32netsvcs%SYSTEMDRIVE%\*.exe/md5st... Read more

Read other 2 answers

Hi I got malwares from videocodec installation. Here are symptoms:1.I have been recieving internet explorer pop-up to the site "yourprivacyguard.com" and "pcsecuresystem.com". 2. Also, Kaspersky detected that my computer has been trying to download something from "http://www.thenetworkcom.com/get-last-update.php?sid=502&aid=610&said=0&pn=5&config=cb" (from the report about 4-8 times every minute). 3. There are fake windows security alert pop-ups saying something that my computer is infected malwares and I need to download program to clean them. 4. My desktop wallpaper changes to some form of a warning sign against a red backdrop (which could be closed when I mouse over the top right hand corner and click on the 'x', after which my wallpaper re-appears)5. 3 web short cuts appear on my desktop labeled Error Cleaner, Privacy Protector, and Spyware &Protection which re-appear everytime after restart.6. There are new internet explorer toolbar: The nssfrch7. The process "explorer.exe" consumes almost 100 percent of cpu and this slow down my computer significantly.I used Kaspersky internet security 7(my anti-virus software), Ad-Aware2007 and Search and Destroy(as suggested by this site) to detect and fix these problems. These fix almost all problems (probem number 1, 3, 4, 5,7). However, problem number 2 is not fixed as Kaspersky still keep reporting that there are contacts between my computer and the site "http://www.... Read more

A:Need Help! Malware Win32.agent.lf, Win32.zlob.cpx. Infected From Videocodec Installation

Welcome to the BleepingComputer HijackThis Logs and Analysis forum nunueng My name is Richie and i'll be helping you to fix your problems.Download SDFix.exe and save it to your desktop:http://downloads.andymanchesta.com/RemovalTools/SDFix.exe* Double click on SDFix on your desktop,and install the fix to C:\ Please then reboot your computer into Safe Mode by doing the following:* Restart your computer* After hearing your computer beep once during startup, but before the Windows icon appears, tap the F8 key continually;* Instead of Windows loading as normal, a menu with options should appear;* Select the first option, to run Windows in Safe Mode, then press "Enter".* Choose your usual account.* In Safe Mode,go to and open the C:\SDFix folder,then double click on RunThis.bat to start the script.* Type Y to begin the script.* It will remove the Trojan Services then make some repairs to the registry and prompt you to press any key to Reboot.* Press any Key and it will restart the PC.* Your system will take longer that normal to restart as the fixtool will be running and removing files.* When the desktop loads the Fixtool will complete the removal and display Finished, then press any key to end the script and load your desktop icons.* Finally open the SDFix folder on your desktop and copy and paste the contents of the results file Report.txt into your next reply.If you have previously downloaded ComboFix,please delete that version now.Now download Combofix an... Read more

Read other 9 answers

hello. sorry about this mess. im afraid i dont really know what im doing. my nephew asked me to help get rid of a red circle with a white cross telling him he had spyware but its turned into something much worse. he only used windows firewall and nothing else saying he only uses world of warcraft and msn and music and doesnt surf the web!! i tried to scan with avg but it was aborted and the windows firewall was continually turned off no matter how many times i put it on. tried other antivirus progs but all were turned off. eventually i managed to do online scan on microsoft safety centre and deleted quite a few v high threat trojans but many unable to clean. i also ran sophos rootkit and nearly gave myself a heart attack - 938 hidden things that recommend not to clean. i resorted to you now. i followed the tutorial for posting hijack this and here are the resultskaspersky report for critical areas--------------------------------------------------------------------------------KASPERSKY ONLINE SCANNER 7 REPORT Saturday, November 29, 2008 Operating System: Microsoft Windows XP Professional Service Pack 3 (build 2600) Kaspersky Online Scanner 7 version: Program database last update: Saturday, November 29, 2008 12:40:36 Records in database: 1426420--------------------------------------------------------------------------------Scan settings: Scan using the following database: extended Scan archives: yes Scan mail databases: yesScan area - Critical Areas: C:\Do... Read more

A:win32/alureon.gen, win32/Eldycow.en!A, win32/Small, win32/Olmafik, winNT/Xantvi.gen!A, Trojan-Game Thief and more

i think i have sorted this. i ran SDFix which cleaned up enough for me to install antivirus. avast caught lots of trojans and i have now been able to onlinescan and spybot s/d etc. all logs now coming back clean so can u delete this post please

Read other 3 answers

hi, my sister recieved an email from her fellow student mate and thought it was crucial and as soon as she opened the email she started to experience anti malware doctor software pop up saying you have recieved threats click yes to remove and so on. ive tried to uninstall that program from safe but it comes back again everytime i log on to desktop. also my avg 9 is picking up loads of the trojan horse cryptic.apo file in the temp folder but canot delete it , it says " interupted by user" and keeps multiplying. i cant seem to surf the net on windows explorer it says page unavilible but i can go online with skype and other messengers. the anti malware doctor pops up every now and then. just cant seem to remove the trojans and anti malware doctor software. ive tried anti malwarebyte in safe mode it found few objects but after restarting to desktop the anti malware doctor automatically installed again on the laptop. ----------------------------------DDS (Ver_10-03-17.01) - NTFSX64 Run by vedika at 1:45:44.03 on 20/07/2010Internet Explorer: 8.0.6001.18928Microsoft? Windows Vista? Home Premium 6.0.6001.1.1252.44.1033.18.2006.619 [GMT 2:00]SP: Windows Defender *enabled* (Updated) {D68DDC3A-831F-4FAE-9E44-DA132C1ACF46}SP: SUPERAntiSpyware *disabled* (Updated) {222A897C-5018-402e-943F-7E7AC8560DA7}============== Running Processes ===============C:\Windows\system32\wininit.exeC:\Program Files (x86)\AVG\AVG9\avgchsva.exeC:\Program Files (x86)\AVG\AVG9\avgrsa.exeC:\Windows\... Read more

A:infected with anti malware doctor with trojan horse cryptic.apo and win32/psw.wow.now and win32. fraudpack. bagn

Hello and Welcome to the forums! My name is Gringo and I'll be glad to help you with your computer problems. Somethings to remember while we are working together.Do not run any other tool untill instructed to do so!Please Do not Attach logs or put in code boxes.Tell me about any problems that have occurred during the fix.Tell me of any other symptoms you may be having as these can help also.Do not run anything while running a fix.In the upper right hand corner of the topic you will see a button called Options. If you click on this in the drop-down menu you can choose Track this topic. By doing this and then choosing Immediate E-Mail notification and then clicking on Proceed you will be advised when we respond to your topic and facilitate the cleaning of your machine.We apologize for the delay in responding to your request for help. Here at Bleeping Computer we get overwhelmed at times, and we are trying our best to keep up. Please note that your topic was not intentionally overlooked. Our mission is to help everyone in need, but sometimes it takes just a little longer to get to every request for help. No one is ignored here.In order for me to see the status of the infection I will need a new set of logs to start with.Please print out or make a copy in notpad of any instructions given, as sometimes it is necessary to go offline and you will lose access to them.DeFogger: Please download DeFogger to your desktop.Double click DeFogger to run the tool. The ap... Read more

Read other 3 answers

(DDS log below)I re-installed my AV after running without it for a while and found that I had quite a few bad things going on picked up by Nod32 including (see attachment for more detail):Win32/Olmarik.ZCJava/TrojanDownloader.Agent.NBEa variant of Win32/Olmarik.UL trojanWin32/Cimag.CL trojanI also get multiple outbound connection attempts which are at least partially being blocked by Nod32 to weird .cc .cn and a few .com domain urls, this happens after performing a google search. Also getting some browser redirects going on and homepage changes.I tried setting nod32 to pre-release updates and performing a full scan, this picked up the above and removed them, but after a reboot there are still things going on. Before reading the steps on this site, I ran the latest ComboFix twice which picked up a rootkit in intelide.sys both times, but appears to come back each time. While I disabled nod32 when I ran ComboFix, it re-enabled upon reboot automatically, not sure if that matters.I've also been getting a startup delay of around 1 minute after logon, in this time, nothing appears to be going on (no apparent CPU or disk activity), but wireless, AV and other startup items do not run. Then a minute later, everthing fires up.I've tried running GMER several times but this keeps giving me a BSOD with IRQL_NOT_LESS_OR_EQUALLast scan with nod32 came up clean but still getting outbound connections and browser redirects.Looking to sort this out once and for all!DDS (Ver_10-03-17.... Read more

A:WinXP rootkit? problem + Win32/Olmarik.ZC Java/TrojanDownloader.Agent.NBE a variant of Win32/Olmarik.UL trojan Win32/Cimag.CL t...

Hi,Welcome to Bleeping Computer. My name is m0le and I will be helping you with your log.Please subscribe to this topic, if you haven't already. You can subscribe by clicking the Options box to the right of your topic title and selecting Track This Topic.Please avoid installing/uninstalling or updating any programs and attempting any unsupervised fixes or scans. This can make helping you impossible.Please reply to this post so I know you are there.The forum is busy and we need to have replies as soon as possible. If I haven't had a reply after 3 days I will bump the topic and if you do not reply by the following day after that then I will close the topic.----------------------------------------------Please download GMER from one of the following locations and save it to your desktop:Main MirrorThis version will download a randomly named file (Recommended)Zipped MirrorThis version will download a zip file you will need to extract first. If you use this mirror, please extract the zip file to your desktop.Disconnect from the Internet and close all running programs.Temporarily disable any real-time active protection so your security programs will not conflict with gmer's driver.Double-click on the randomly named GMER file (i.e. n7gmo46c.exe) and allow the gmer.sys driver to load if asked.Note: If you downloaded the zipped version, extract the file to its own folder such as C:\gmer and then double-click on gmer.exe.GMER will open to the Rootkit/Malware tab and perfor... Read more

Read other 14 answers

Hi, im having a problem with popups. When I run Avast it finds files and gets rid of them but it seems that every time i do a scan it picks up something new. here is a list of the files its deleted so far.

A0007433.dll win32:trojan-gen
A0007484.dll win32:rootkit-gen
A0007485.dll win32:adware-gen
geBqQJYp.dll win32:trojan-gen
pmnOHXoL.dll win32:rootkit-gen
trz1.tmp win32:rootkit-gen
tuvvpjgd.dll win32:adware-gen

here is the DDS log

DDS (Ver_09-01-19.01) - NTFSx86
Run by Administrator at 7:09:47.25 on Mon 01/26/2009
Internet Explorer: 7.0.5730.13
Microsoft Windows XP Professional 5.1.2600.3.1252.1.1033.18.510.250 [GMT -5:00]

AV: avast! antivirus 4.8.1296 [VPS 090125-0] *On-access scanning disabled* (Updated)

============== Running Processes ===============

C:\WINDOWS\system32\svchost -k DcomLaunch
C:\WINDOWS\System32\svchost.exe -k netsvcs
C:\WINDOWS\system32\svchost.exe -k WudfServiceGroup
C:\Program Files\Alwil Software\Avast4\aswUpdSv.exe
C:\Program Files\Alwil Software\Avast4\ashServ.exe
C:\Program Files\Common Files\Apple\Mobile Device Support\bin\AppleMobileDeviceService.exe
C:\Program Files\Bonjour\mDNSResponder.exe
C:\Program Files\Java\jre6\bin\jqs.exe
C:\WINDOWS\system32\svchost.exe -k imgsvc
C: ... Read more

A:Pop ups, win32:trojan-gen, win32:adware-gen, win32:rootkit-gen

Please make sure you disable ALL of your Antivirus/Antispyware/Firewall before running ComboFix.. Please visit HERE if you don't know how.. Please re-enable them back after performing all steps given..Please download ComboFix by sUBs from one of the locations below, and save it to your Desktop.Link 1Link 2Link 3Double click combofix.exe and follow the prompts. Please, never rename Combofix unless instructed.If ComboFix asked you to install Recovery Console, please do so.. It will be your best interest..When finished, it shall produce a log for you. Post that log and a fresh HijackThis log in your next reply..Note: DON'T do anything with your computer while ComboFix is running.. Let ComboFix finishes its job..

Read other 8 answers

Hello all,Because of my careless actions while using my computer and IM i got infected and now i cant get rid of it. Im getting now ad pop-up's only, and i think i got rid of some infections that came but still there are left a few. I got this infection about a week ago. Computer hasnt been used much after that 'cos i had to go away for a week and didnt have time to try to fix it then. Now i tried to fight with this for a couple of days, but no glorious victory for me here.Kaspersky's online scan report is last in my postIf you have time and knowledge to help me, i would appreciate it.Thanks in advancemain.txt:Deckard's System Scanner v20071014.68Run by Jaybird on 2008-06-07 14:21:17Computer is in Normal Mode.---------------------------------------------------------------------------------- HijackThis (run as Jaybird.exe) ---------------------------------------------Logfile of Trend Micro HijackThis v2.0.2Scan saved at 14:21:28, on 7.6.2008Platform: Windows XP SP2 (WinNT 5.01.2600)MSIE: Internet Explorer v7.00 (7.00.6000.16640)Boot mode: NormalRunning processes:C:\WINDOWS\System32\smss.exeC:\WINDOWS\system32\winlogon.exeC:\WINDOWS\system32\services.exeC:\WINDOWS\system32\lsass.exeC:\WINDOWS\system32\Ati2evxx.exeC:\WINDOWS\system32\svchost.exeC:\WINDOWS\System32\svchost.exeC:\WINDOWS\system32\Ati2evxx.exeC:\WINDOWS\system32\spoolsv.exeC:\W... Read more

A:Infected With Win32.virtumonde/win32.monde/win32.ircbot

Hello Jay-EM and welcome to BleepingComputer,1. * Clean your Cache and Cookies in IE:Close all instances of Outlook Express and Internet Explorer Go to Control Panel > Internet Options > General tabUnder Browsing History, click Delete. Click Delete Files, Delete cookies and Delete historyClick Close below.* Clean your Cache and Cookies in Firefox (In case you also have Firefox installed):Go to Tools > Options.Click Privacy in the menu..Click the Clear now button below.. A new window will popup what to clear.Select all and click the Clear button again.Click OK to close the Options window* Clean other Temporary files + Recycle bin Go to start > run and type: cleanmgr and click ok. Let it scan your system for files to remove. Make sure Temporary Files, Temporary Internet Files, and Recycle Bin are the only things checked.Press OK to remove them.2. Please download Malwarebytes' Anti-Malware from Here or HereDoubleclick mbam-setup.exe to install the application.Make sure a checkmark is placed next to Update Malwarebytes' Anti-Malware and Launch Malwarebytes' Anti-Malware, then click Finish.If an update is found, it will download and install the latest version.Once the program has loaded, select "Perform Quick Scan", then click Scan.The scan may take some time to finish,so please be patient.When the scan is complete, click OK, then Show Results to view the results.Make sure that everything is checked, and click Remove Selected.When disinfection is completed,... Read more

Read other 2 answers

My Dell has been infected at the root level with what has been identified by ASWmbr as Win32:Evo-gen and by Avast! on boot scan as Win32:Malware-gen. They can find the malware but are unable to get rid of it. I have also tried MalwareBytes, RKiller.
Any recommendations?
Neal Lewis
[email protected]
Here is the log:
DDS (Ver_2012-11-20.01) - NTFS_x86
Internet Explorer: 8.0.6001.18702  BrowserJavaVersion: 1.4.2_03
Run by W. Neal Lewis at 21:58:37 on 2013-10-17
Microsoft Windows XP Home Edition  5.1.2600.3.1252.1.1033.18.510.103 [GMT -5:00]
AV: avast! Antivirus *Enabled/Updated* {7591DB91-41F0-48A3-B128-1A293FD8233D}
============== Running Processes ================
C:\Program Files\Alwil Software\Avast5\AvastSvc.exe
C:\Program Files\Analog Devices\Core\smax4pnp.exe
C:\Program Files\Dell\Media Experience\PCMService.exe
C:\Program Files\Real\RealPlayer\RealPlay.exe
C:\Program Files\Seagate\SystemTray\StxMenuMgr.exe
C:\Program Files\Alwil Software\Avast5\avastUI.exe
C:\Program Files\Dell Support\DSAgnt.exe
C:\Program Files\GoZone\GoZone_iSync.exe
C:\Program Files\Seagate\Sync\SeaSyncServices.exe
C:\Program Files\Mozilla Firefox\firefox.exe
C:\WINDOWS\system32\wb... Read more

A:Computer infected with Win32:Evo-gen or Win32:Malware-gen

Hello wnlewis I would like to welcome you to the Malware Removal section of the forum.Around here they call me Gringo and I will be glad to help you with your malware problems.Very Important --> Please read this post completely, I have spent my time to put together somethings for you to keep in mind while I am helping you to make things go easier, faster and smoother for both of us!Please do not run any tools unless instructed to do so.We ask you to run different tools in a specific order to ensure the malware is completely removed from your machine, and running any additional tools may detect false positives, interfere with our tools, or cause unforeseen damage or system instability.Please do not attach logs or use code boxes, just copy and paste the text.Due to the high volume of logs we receive it helps to receive everything in the same format, and code boxes make the logs very difficult to read. Also, attachments require us to download and open the reports when it is easier to just read the reports in your post.Please read every post completely before doing anything.Pay special attention to the NOTE: lines, these entries identify an individual issue or important step in the cleanup process.Please provide feedback about your experience as we go.A short statement describing how the computer is working helps us understand where to go next, for example: I am still getting redirected, the computer is running normally, etc. Please do not describe the computer as "the same",... Read more

Read other 28 answers

avast has been detecting Win32:Alureon-EC[Rtk] and VBS:Malware-gen and WIn32:VB-NSA[Drp]...when you click "Move to Chest" nothing is happening..tried using Malware Bytes but unable to remove it...

As suggested in the Preparation Guide I have attached DDS and RootRepeal logs..Thank you!

DDS (Ver_09-10-26.01) - NTFSx86
Run by user at 9:20:27.81 on Fri 11/20/2009
Internet Explorer: 7.0.5730.13
Microsoft Windows XP Professional 5.1.2600.3.1252.1.1033.18.1023.604 [GMT 8:00]

AV: avast! antivirus 4.8.1356 [VPS 091120-1] *On-access scanning enabled* (Updated) {7591DB91-41F0-48A3-B128-1A293FD8233D}

============== Running Processes ===============

C:\WINDOWS\system32\svchost -k DcomLaunch
C:\WINDOWS\System32\svchost.exe -k netsvcs
C:\Program Files\Alwil Software\Avast4\aswUpdSv.exe
C:\Program Files\Alwil Software\Avast4\ashServ.exe
C:\Program Files\Java\jre6\bin\jusched.exe
C:\Program Files\Java\jre6\bin\jqs.exe
C:\Program Files\Malwarebytes' Anti-Malware\mbamservice.exe
C:\Program Files\Alwil Software\Avast... Read more

A:infected Win32:Alureon-EC[Rtk] / WIn32:VB-NSA[Drp] / VBS:Malware-gen

Hello and welcome to Bleeping ComputerWe apologize for the delay in responding to your request for help. Here at Bleeping Computer we get overwhelmed at times, and we are trying our best to keep up. Please note that your topic was not intentionally overlooked. Our mission is to help everyone in need, but sometimes it takes just a little longer to get to every request for help. No one is ignored here.If you have since resolved the original problem you were having, we would appreciate you letting us know. If not please perform the following steps below so we can have a look at the current condition of your machine. If you have not done so, include a clear description of the problems you're having, along with any steps you may have performed so far.Upon completing the steps below another staff member will review and take the steps necessary with you to get your machine back in working order clean and free of malware.If you have already posted a DDS log, please do so again, as your situation may have changed.Use the 'Add Reply' and add the new log to this thread.Thanks and again sorry for the delay.We need to see some information about what is happening in your machine. Please perform the following scan:Download DDS by sUBs from one of the following links. Save it to your desktop.DDS.scrDDS.pifDouble click on the DDS icon, allow it to run.A small box will open, with an explaination about the tool. No input is needed, the scan is running.Notepad will open with the results.Foll... Read more

Read other 2 answers

Hello all,
a few days ago i suddenly had a popup from an unknown software called SecurityTool that installed itself on my pc and claimed i have a lot of infections and viruses. after googling its name i realized that was a fake thing and that SecurityTool is actually a harmful software so i followed some online instructions on how to remove it. (deleting files and registry entries..) it all made sense, basically a manual software removal procedure.
after that, my antivirus (avast home) started finding many trojan and malware infections in files on my pc. i ran a few scans with avast (not before updating it of course) but the infected files just kept being created everytime i had them deleted with avast.
i looked at what services i had running and did some research on all the names i couldnt recognize, and found that some might be malwares, others definitely malwares so i ran scans with "spybot s&d" and "malwarebyte's anti malware" and cleaned most of the things they reported. other infections which avast was reporting and i couldnt find with the previously mentioned scans i had to google and see how to manually remove.
finally, it seemed as though i got things under control but than after a couple of quiet days, i tried making sure all is well and ran an antivirus scan again, avast found yet some more infected files. they somehow keep popping up here.. in new places. some scans turn out clean and the day after again, infected files. and also suddenly ... Read more

A:infected ith various win32:malware-gen and win32:trojan-gen

no one? please?

Read other 22 answers

A few days ago Spyware doctor started picking up malware on my machine which I removed (for example: Trojan.Hiloti.Gen). Subsequently my browser started redirecting me frequently so I downloaded the free version of Avast and ran a boot scan. That scan found Win32:Malware-gen in 6 files (3 on my C drive and the backup of those files on my USB H: drive were also infected), and Win32:Hupigon-ONX in the file C:\hiberfil.sys.McAfee and Avast do not pick up these infections during normal scans, nor does MalWareBytes or Spyware Doctor. Avast was unable to remove the infections during the boot scan; the infected files are Visual C *.cab files and the program claimed to be unable to delete or sequester the files in the Virus Chest.I need help figuring out how to remove these infections. I followed your instructions and have generated logs with DDS. However I have been unable to generate a log with GMER and need help.I have been trying for 3+ days to generate the GMER file; however the computer bluescreened after 4 hours the first time (PFN_LIST_CORRUPT). The second time I ran it in Safe mode with networking disabled and the computer bluescreened at some point after at least 14 hours (I was asleep; no specific message only a stop location). The third attempt was also made in safe mode, and the computer apparently rebooted itself while I was away at work, losing the scan again.I am posting my DDS file below and attaching the second file as instructed. I would appreciate any help... Read more

A:Infected with Win32:Malware-gen and Win32:Hupigon-ONX

Hello , And to the Bleeping Computer Malware Removal Forum. My name is Elise and I'll be glad to help you with your computer problems.I will be working on your malware issues, this may or may not solve other issues you may have with your machine.Please note that whatever repairs we make, are for fixing your computer problems only and by no means should be used on another computer.The cleaning process is not instant. Logs can take some time to research, so please be patient with me. I know that you need your computer working as quickly as possible, and I will work hard to help see that happen. Please reply using the Add/Reply button in the lower right hand corner of your screen. Do not start a new topic. The logs that you post should be pasted directly into the reply. Only attach them if requested or if they do not fit into the post.Unfortunately, if I do not hear back from you within 5 days, I will be forced to close your topic. If you still need help after I have closed your topic, send me or a moderator a personal message with the address of the thread or feel free to create a new one.You may want to keep the link to this topic in your favorites. Alternatively, you can click the button at the top bar of this topic and Track this Topic, where you can choose email notifications. The topics you are tracking are shown here.-----------------------------------------------------------If you have since resolved the original problem you were having, we would appreciate you... Read more

Read other 17 answers

I ran avast virus scan tonight and it came up with Win32:Malware-gen and when it asked to reboot so it could get rid of it, it ran another scan that found Win32:Installerex-x [PUP].
I would post a log but when I run DDS I get the following error:
"DDS is not meant to run in 'Compatibility Mode'. The program shall now exit." 
I am using Windows 8 with Avast! as my anti-virus program. 

A:Infected with Win32:Malware-gen and Win32:Installerex-X[PUP]

Hello and welcome to Bleeping Computer! I am HelpBot: an automated program designed to help the Bleeping Computer Staff better assist you! This message contains very important information, so please read through all of it before doing anything.
We apologize for the delay in responding to your request for help. Here at Bleeping Computer we get overwhelmed at times, and we are trying our best to keep up. Please note that your topic was not intentionally overlooked. Our mission is to help everyone in need, but sometimes it takes just a little longer to get to every request for help. No one is ignored here.
To help Bleeping Computer better assist you please perform the following steps:
*************************************************** In order to continue receiving help at BleepingComputer.com, YOU MUST tell me if you still need help or if your issue has already been resolved on your own or through another resource! To tell me this, please click on the following link and follow the instructions there.CLICK THIS LINK >>> http://www.bleepingcomputer.com/logreply/518135 <<< CLICK THIS LINK
If you no longer need help, then all you needed to do was the previous instructions of telling me so. You can skip the rest of this post. If you do need help please continue with Step 2 below.
***************************************************If you still need help, I would like you to post a Reply to this topic (click the "Add Reply" button in the lower right hand of t... Read more

Read other 10 answers

Hi, here is my problem. Everytime I download some movies or other things by opening my computer overnight, it must pop out a error window said:-C:\Documents and setting\KkianN\Desktop is not accessible.Not enough quota is available to process this command.The icons only left on my screen were My computer,my network places and Internet explorer. When I refresh my computer, it came out the same message again.(this problem was occured when I opened my computer overnight by using Thunder5 this software to download things)When I tried to shut down, a message said You do not have permission to shut down this computer.When I tried to use windows task manager to shut down,once i click Ctrl+Alt+Del, an application error message came out said:-This application failed to initialize properly(0xc000012d). Click on OK to terminate the application.Then I just can reset my computer.Actually I have posted in BleepingComputer.com > Security > Am I infected? What do I do? there.Then I followed the instruction in "Preparation Guide For Use Before Posting A Hijackthis Log". Unfortunately,i can't finish all the steps there. For step 4, I can't remove win32.generic.pws,win32.trojan.psw.delf and Win32.trojan.pws.onlinegames by using Ad-aware 2007. While scanning by using spybot,it stuck while scanning.After that suddenly pop out a window said:-Spybot-Search and destroy has detected an important registry entry that has been changed. Category: System Startup global entr... Read more

A:Infected With Dropper.agent,logger.pcap.a,win32.generic.pws,win32.trojan.psw.delf And Win32.trojan.pws.onlinegames

Hello, I had reformatted my computer since it could not open and stuck in the welcome window few days ago. So, now my computer is alright..thanks for viewing and trying to help me to fix the problem.

Read other 1 answers

Originally Virus Heat installed itself onto my computer then we added CA Security anti virus and anti spyware protection. This cleaned up some of the problem but I had to download spybot search and destroy to find more spyware. There was a lot of Z lob spyware on the computer. I have spent countless hours on the phone with tech support with Time Warner who is my internet provider who suggested the CA Security that isn't picking up on everything. Now when I run a full scan with CA on my computer it says there are no infections but I keep getting a pop up from CA saying there are 33 infected items. The pop up is random- it isn't in connection with the anti-virus scan. They aren't deleted or quarentened, the pop up just states the file name, infection name, type which is "file" and status which is infected. There are 10 win32/vmalum.ccpy, 19 win32/crushpy!generic, 1 win32/vmalum.ccqd, 2 win32/bewschy.d and 1 vmalum.ccqa. The files aren't quarentened so I can't go in and delete them and when I run the scan to clean them up it isn't picking up on them. So CA anti virus scan isn't picking up on these infected files but then again it is because the pop up knows they are there? Does this make sense? Almost like it knows they are there but it can't do anything with them? Time Warner suggested I get a trojan hunter, is this appropriate? Are you familiar with these infection types? I have googled the names but nothing comes u... Read more

A:Win32/bewschy.d, Win32/vmalum.ccpy, Win32/vmalum.ccqa,win32/crushpy!generic, Win32/vmalum.ccqd

What OS (Win 2K, XPsp1, XPsp2, Vista) are you using? Have you tried doing your scans in "Safe Mode"? Are you doing scans while logged into the "Administrator Account" or an "account with administrator privileges"? You need to start there first. If rescanning in Safe Mode does not help, then do this:Please perform an online scan with Kaspersky WebScannerClick on You will be promted to install an ActiveX component from Kaspersky, Click The program will launch and then begin downloading the latest definition files:Once the files have been downloaded click on Now click on In the scan settings make that the following are selected:Scan using the following Anti-Virus database:Extended (if available otherwise Standard)
Scan Options:Scan Archives
Scan Mail BasesClick Now under select a target to scan:Select My ComputerThis will program will start and scan your system.The scan will take a while so be patient and let it run.Once the scan is complete it will display if your system has been infected.Now click on the Save as Text button:Save the file to your desktop.Copy and paste the scan results in your next reply.

Read other 11 answers

I started noticed a couple weeks ago that my computer would link itself to advertisements. Downloaded AVast and it found the following:

win32:Sirefef-PL AND win32:Sirefef-(with other letters)

I completed the DeFogger and I didn't do the GMER as it says not to for 64-bit.

I tried to check on my firewall, but when I clicked 'use recommended settings' it says "Error Code: 0x80070424".

Even though I ran the Avast Boot Scanner and it said it deleted the files.. Avast pops up saying "Trojan blocked" or "Malware blocked" all the time so I know I am still infected.



DDS (Ver_2011-08-26.01) - NTFSAMD64
Internet Explorer: 9.0.8112.16421
Run by Rachel at 14:59:18 on 2012-08-22
Microsoft Windows 7 Home Premium 6.1.7601.1.1252.1.1033.18.3894.2044 [GMT -4:00]
SP: Windows Defender *Disabled/Updated* {D68DDC3A-831F-4fae-9E44-DA132C1ACF46}
============== Running Processes ===============
C:\Windows\system32\svchost.exe -k DcomLaunch
C:\Windows\system32\svchost.exe -k RPCSS
C:\Windows\System32\svchost.exe -k LocalServiceNetworkRestricted
C:\Windows\System32\svchost.exe -k LocalSystemNetworkRestricted
C:\Windows\system32\svchost.exe -k netsvcs
C:\Windows\system32\svchost.exe -k LocalService
C:... Read more


Greetings and Welcome to The Forums!!My name is Gringo and I'll be glad to help you with your computer problems.I have put together somethings for you to keep in mind while I am helping you to make things go easier and faster for both of usPlease do not run any tools unless instructed to do so.
We ask you to run different tools in a specific order to ensure the malware is completely removed from your machine, and running any additional tools may detect false positives, interfere with our tools, or cause unforeseen damage or system instability.Please do not attach logs or use code boxes, just copy and paste the text.
Due to the high volume of logs we receive it helps to receive everything in the same format, and code boxes make the logs very difficult to read. Also, attachments require us to download and open the reports when it is easier to just read the reports in your post.Please read every post completely before doing anything.
Pay special attention to the NOTE: lines, these entries identify an individual issue or important step in the cleanup process.Please provide feedback about your experience as we go.
A short statement describing how the computer is working helps us understand where to go next, for example: I am still getting redirected, the computer is running normally, etc. Please do not describe the computer as "the same", this requires the extra step of looking back at your previous post.NOTE: At the ... Read more

Read other 23 answers

ya heading has list of viruses in my computer per the avast boottime scan ..im not sure how to remove em

A:win32:pswtool_L/win32 malware-gen/win32:funweb

Please download Malwarebytes Anti-Malware and save it to your desktop.Download Link 1Download Link 2MBAM may "make changes to your registry" as part of its disinfection routine. If using other security programs that detect registry changes (ie Spybot's Teatimer), they may interfere or alert you. Temporarily disable such programs or permit them to allow the changes.Make sure you are connected to the Internet.Double-click on mbam-setup.exe to install the application.
For instructions with screenshots, please refer to the How to use Malwarebytes' Anti-Malware Guide.When the installation begins, follow the prompts and do not make any changes to default settings.When installation has finished, make sure you leave both of these checked:Update Malwarebytes' Anti-MalwareLaunch Malwarebytes' Anti-MalwareThen click Finish.MBAM will automatically start and you will be asked to update the program before performing a scan.If an update is found, the program will automatically update itself. Press the OK button to close that box and continue.If you encounter any problems while downloading the definition updates, manually download them from here and just double-click on mbam-rules.exe to install.On the Scanner tab:Make sure the "Perform Quick Scan" option is selected.Then click on the Scan button.If asked to select the drives to scan, leave all the drives selected and click on the Start Scan button.The scan will begin and "Scan in progress" will show at the top. It may take some time to comp... Read more

Read other 4 answers

KASPERSKY ONLINE SCANNER 7 REPORTSaturday, November 29, 2008Operating System: Microsoft Windows XP Professional Service Pack 3 (build 2600)Kaspersky Online Scanner 7 version: database last update: Friday, November 28, 2008 18:35:48Records in database: 1424124Scan settingsScan using the following database extendedScan archives yesScan mail databases yesScan area My ComputerC:\D:\E:\F:\Scan statisticsFiles scanned 94300Threat name 4Infected objects 4Suspicious objects 0Duration of the scan 02:45:29File name Threat name Threats countC:\Documents and Settings\All Users\Application Data\FreeApp.exe Infected: Trojan.Win32.Agent.arng 1 C:\Qoobox\Quarantine\C\Program Files\tinyproxy\tinyproxy.exe.vir Infected: Trojan-Proxy.Win32.Agent.bcw 1 C:\RECYCLER\S-1-5-21-1482476501-1644491937-682003330-1013\winse32.exe Infected: IRC-Worm.Win32.Small.x 1 C:\WINDOWS\bolivar24.exe Infected: Backdoor.Win32.Agent.ubx 1 The selected area was scanned.----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Logfile of random's system information tool 1.04 (written by random/random... Read more

A:Infected: Trojan.Win32.Agent.arng, Trojan-Proxy.Win32.Agent.bcw, IRC-Worm.Win32.Small.x, Backdoor.Win32.Agent.ubx

Hello and to Bleeping ComputerWe apologize for the delay in responding to your request for help. Here at Bleeping Computer we get overwhelmed at times, and we are trying our best to keep up. Please note that your topic was not intentionally overlooked. Our mission is to help everyone in need, but sometimes it takes just a little longer to get to every request for help.If you have since resolved the original problem you were having, we would appreciate you letting us know. If not please perform the following steps below so we can have a look at the current condition of your machine. If you have not done so, include a description of your problem, along with any steps you may have performed so far.Upon completing the steps below a staff member will review and take the steps necessary with you to get your machine back in working order clean and free of malware.Thanks and again sorry for the delay.We need to see some information about what is happening in your machine. Please perform the following scan:Download DDS by sUBs from one of the following links. Save it to your desktop.DDS.comDDS.scrDDS.pifDouble click on the DDS icon, allow it to run.A small box will open, with an explaination about the tool. No input is needed, the scan is running.Notepad will open with the results, click no to the Optional_ScanFollow the instructions that pop up for posting the results.Close the program window, and delete the program from your desktop.Please note: You may have to disable any scr... Read more

Read other 4 answers


Please help. Along with the above virus? names I have an icon down in the bottom right corner that flashes from a yellow X to a yellow ? with a message telling me I have a Critical System error and to go to that site and download software....

I have AVAST and ran a full scan and did come up with several files with virus/trojan names; these files went into the Virus Chest. I deleted the Temp ones but decided not to delete anything else until I know what is going on. I have since ran the Clean Up through Avast and rescanned twice. Did not show any new stuff although there were 6 files that it was not able to scan. It appears that my C drive has all the problems.

One other thing I did notice was that when I went into Device Manager there is the big yellow question mark next to something identified as optional device and below that another question mark as RAID something. Also, down below the volume game controller file? there are several things that have a big yellow exclamation marks......

Someone showed me last night the process to remove the Adware(??) and the icon and clean this up and but I was not at home so I just reviewed the info, decided that I should be able to do it and just wrote down this website address. So, now I have here but do not know where to get started.................

Thanks for you help!

A:Win32:zlob; Win32:ageng-a; Win32:adan-007; Win32:enumplus And On And On

Sorry you didn't get a reply sooner.Here's what to do.Follow the directions in this topic: http://www.bleepingcomputer.com/forums/t/34773/preparation-guide-for-use-before-using-malware-removal-tools-and-requesting-help/Then post a new topic with your HJT log here: http://www.bleepingcomputer.com/forums/f/22/virus-trojan-spyware-and-malware-removal-logs/Provide a brief description of your problem, and provide a title similar to the one you have here.Please be patient, as the HJT team is very busy. Do not bump your log as the team may think that someone is already helping you. If you have not had a response in five days add a reply to this topic: http://www.bleepingcomputer.com/forums/topic14717.html and paste in the link to your HJT topic there.Orange Blossom

Read other 1 answers

i am sorry to post a log over here, as i have read through the forum and try to resolve the problem on my own but i failed.since i had ran the comboFix, so i feel that it may be of help to post it.sorry for the trouble..here's the log file...ComboFix 09-07-28.06 - Bentley 07/30/2009 0:35.1.8 - NTFSx86Microsoft? Windows Vista? Ultimate 6.0.6001.1.1252.1.1033.18.3069.1872 [GMT 8:00]Running from: c:\users\Bentley\Desktop\ComboFix.exeSP: SUPERAntiSpyware *disabled* (Updated) {222A897C-5018-402e-943F-7E7AC8560DA7}SP: Windows Defender *enabled* (Updated) {D68DDC3A-831F-4FAE-9E44-DA132C1ACF46} * Created a new restore point.((((((((((((((((((((((((((((((((((((((( Other Deletions ))))))))))))))))))))))))))))))))))))))))))))))))).c:\windows\Install.txtc:\windows\system32\tmp0_144047822718.bkc:\windows\system32\tmp0_16962678345.bkc:\windows\system32\tmp0_205418834021.bkc:\windows\system32\tmp0_355351885288.bkc:\windows\system32\tmp0_424346226483.bkc:\windows\system32\tmp0_516880812123.bkc:\windows\system32\tmp0_517948877969.bkc:\windows\system32\tmp0_525286544717.bkc:\windows\system32\tmp0_687442396617.bkc:\windows\system32\tmp0_77071886817.bkc:\windows\system32\tmp0_779592338841.bkc:\windows\system32\tmp0_790261416358.bkc:\windows\system32\tmp2_1075327197... Read more

A:Infected with win32/rootkit.agent.ODG trojan and win32/Olmarik.JU trojan

Hello and welcome to Bleeping ComputerWe apologize for the delay in responding to your request for help. Here at Bleeping Computer we get overwhelmed at times, and we are trying our best to keep up. Please note that your topic was not intentionally overlooked. Our mission is to help everyone in need, but sometimes it takes just a little longer to get to every request for help. No one is ignored here.If you have since resolved the original problem you were having, we would appreciate you letting us know. If not please perform the following steps below so we can have a look at the current condition of your machine. If you have not done so, include a clear description of the problems you're having, along with any steps you may have performed so far.Upon completing the steps below another staff member will review and take the steps necessary with you to get your machine back in working order clean and free of malware.If you have already posted a DDS log, please do so again, as your situation may have changed.Use the 'Add Reply' and add the new log to this thread.Thanks and again sorry for the delay.We need to see some information about what is happening in your machine. Please perform the following scan:Download DDS by sUBs from one of the following links. Save it to your desktop.DDS.scrDDS.pifDouble click on the DDS icon, allow it to run.A small box will open, with an explaination about the tool. No input is needed, the scan is running.Notepad will open with the results.Foll... Read more

Read other 2 answers

My computer has been infected with Win32/Rootkit.Agent.ODG trojan and Win32/Olmarik.JU trojan. AVG, ESET NOD32, and Avira couldn't delete it, and I want to delete it. It redirected all Google searches and slows down my computer. Can you please help me. Thanks ahead to anyone who can help.Here is the HJT logfile:Logfile of Trend Micro HijackThis v2.0.2Scan saved at 2:28:51 PM, on 18/08/2009Platform: Windows XP SP3 (WinNT 5.01.2600)MSIE: Internet Explorer v8.00 (8.00.6001.18702)Boot mode: NormalRunning processes:C:\WINDOWS\System32\smss.exeC:\WINDOWS\system32\winlogon.exeC:\WINDOWS\system32\services.exeC:\WINDOWS\system32\lsass.exeC:\WINDOWS\system32\Ati2evxx.exeC:\WINDOWS\system32\svchost.exeC:\Program Files\Windows Defender\MsMpEng.exeC:\WINDOWS\System32\svchost.exeC:\WINDOWS\system32\svchost.exeC:\WINDOWS\system32\ZoneLabs\vsmon.exeC:\Program Files\CheckPoint\ZAForceField\IswSvc.exeC:\WINDOWS\system32\LEXBCES.EXEC:\WINDOWS\system32\spoolsv.exeC:\WINDOWS\system32\LEXPPS.EXEC:\WINDOWS\Explorer.EXEC:\Program Files\Avira\AntiVir Desktop\sched.exeC:\Program Files\Avira\AntiVir Desktop\avguard.exeC:\Program Files\Common Files\Apple\Mobile Device Support\bin\AppleMobileDeviceService.exeC... Read more

A:Infected with Win32/Rootkit.Agent.ODG trojan and Win32/Olmarik.JU trojan

Hello and to Bleeping ComputerWe apologize for the delay in responding to your request for help. Here at Bleeping Computer we get overwhelmed at times, and we are trying our best to keep up. Please note that your topic was not intentionally overlooked. Our mission is to help everyone in need, but sometimes it takes just a little longer to get to every request for help. No one is ignored here.If you have since resolved the original problem you were having, we would appreciate you letting us know. If not please perform the following steps below so we can have a look at the current condition of your machine. If you have not done so, include a clear description of the problems you're having, along with any steps you may have performed so far.Upon completing the steps below another staff member will review and take the steps necessary with you to get your machine back in working order clean and free of malware.If you have already posted a DDS log, please do so again, as your situation may have changed.Use the 'Add Reply' and add the new log to this thread.Thanks and again sorry for the delay.-----------------------------------------------------------We need to see some information about what is happening in your machine. Please perform the following scan:Download DDS by sUBs from one of the following links. Save it to your desktop.DDS.scrDDS.pifDouble click on the DDS icon, allow it to run.A small box will open, with an explaination about the tool. No input is needed, ... Read more

Read other 20 answers

HiWanted to start off by saying you guys in this forum are awesome. Thanks for all your help and expertise, you guys are honestly a godsend. I say this because following someone else's case in the forums has helped me. I was on the verge of formatting and re-installing and now my computer is usable. Beginning with viruses that have been causing blue screens for the last three days, they have pretty much all stopped now. The only issue I have now is sometimes my computer would slow right down. Watching videos or listening to audio it would drag, stagger, pause. I have not used any other programs yet, so I haven't seen the effects in anything other than my internet browser. Perhaps the GMER scan took longer as well. Task manager shows cpu and mem usage as quite normal and not peaking.The steps I have used up to this point:1. Scanned with Microsoft Security Essentials. Detected Trojan:Win32.RimecudA2. Scanned with Kaspersky Rescue Disk. Removed quite a few things. I think I have logs.3. Scanned with Malwarebyte's Anti-Malware.It couldn't remove Trojan.Bubnix which appeared as a chmnoti.sys file in my Windows/System32/drivers folder. It would say it needed to restart the computer and upon restarting the file would still be in there.I moved it onto my Ubuntu desktop and it's still there atm. Probably not the best way to do it, but I'm going to assume it's not going to do anything sitting there for now.After this, the blue screens would still appear when... Read more

A:Disinfected Trojan.Bubnix and Rootkit.Win32.TDSS.tdl4. Still have Win32.Palevo

Hi,Welcome to Bleeping Computer. My name is m0le and I will be helping you with your log.Please subscribe to this topic, if you haven't already. Click the Watch This Topic button at the top on the right.

Please avoid installing/uninstalling or updating any programs and attempting any unsupervised fixes or scans. This can make helping you impossible.

Please reply to this post so I know you are there.The forum is busy and we need to have replies as soon as possible. If I haven't had a reply after 3 days I will bump the topic and if you do not reply by the following day after that then I will close the topic.Once I receive a reply then I will return with your first instructions.Thanks

Read other 18 answers

I have two problems that I think are a result of one virus. The fist problem and most annoying is when connected to internet my system will pop up with an general error message: ?Generic host Win32 Services has encountered and error? and then the system will display a shutdown prompt under the ?NT AUTHORITY? and the system shutsdown in 60 seconds. The system doesn?t shut down when not connected to the internet and it only has to be connect to the net not when I?m actively using the connectionThe other problem is when I run kaspersky internet security 2009 that is completely updated it comes up with the virus ?Rootkit.win32.tdss.d? but it is unable to remove this virus.Also I noticed when I look at the system properties from the general tab in the control panel it says Window XP media center 2002 edition SP3 but when I look at system information in the system tools it says the following:OS Name Microsoft Windows XP ProfessionalVersion 5.1.2600 Service Pack 3 Build 2600OS Manufacturer Microsoft CorporationSystem Name IKEBOWLSystem Manufacturer TOSHIBASystem Model Satellite A100System Type X86-based PCProcessor x86 Family 6 Model 14 Stepping 8 GenuineIntel ~1729 MhzBIOS Version/Date Phoenix Technologies LTD 1.70, 5/11/2006SMBIOS Version 2.31Windows Directory C:\WINDOWSSystem Directory C:\WINDOWS\system32Boot Device \Device\HarddiskVolume1Locale United StatesHardware Abstraction Layer Version = "5.1.2600.5512 (xpsp.080413-2111)"User Name IKEBO... Read more

A:Win32 generic Error/NT Authority Shutdown & Rootkit.win32.tdss.d virus

Also here is the Hijackthis LOG:Logfile of Trend Micro HijackThis v2.0.2Scan saved at 11:54:37 PM, on 2/6/2010Platform: Windows XP SP3 (WinNT 5.01.2600)MSIE: Internet Explorer v8.00 (8.00.6001.18702)Boot mode: NormalRunning processes:C:\WINDOWS\System32\smss.exeC:\WINDOWS\system32\winlogon.exeC:\WINDOWS\system32\services.exeC:\WINDOWS\system32\lsass.exeC:\Program Files\Webroot\Spy Sweeper\WRConsumerService.exeC:\WINDOWS\system32\svchost.exeC:\Program Files\Windows Defender\MsMpEng.exeC:\WINDOWS\System32\svchost.exeC:\Program Files\Intel\Wireless\Bin\EvtEng.exeC:\Program Files\Intel\Wireless\Bin\S24EvMon.exeC:\WINDOWS\system32\spoolsv.exeC:\WINDOWS\Explorer.EXEC:\Program Files\TOSHIBA\ConfigFree\CFSvcs.exeC:\WINDOWS\system32\DVDRAMSV.exeC:\WINDOWS\eHome\ehRecvr.exeC:\WINDOWS\system32\TDispVol.exeC:\WINDOWS\system32\igfxtray.exeC:\WINDOWS\system32\hkcmd.exeC:\WINDOWS\eHome\ehSched.exeC:\WINDOWS\system32\igfxpers.exeC:\Program Files\Java\jre6\bin\jqs.exeC:\WINDOWS\ehome\ehtray.exeC:\Program Files\Toshiba\Toshiba Applet\thotkey.exeC:\Program Files\Kodak\printer\center\KodakSvc.... Read more

Read other 3 answers

Hello,My name is Raj and I am a new member to this forum. Let me thank you, first of all, for all the help you all provide with solving these nasty issues. Now here is my situation.My problems started when my IE web pages did not load inspite of having good wireless connection. I ran AVG free and got the web browsing back. But then my CMD and regEdit tools would not work. I ran Spybot S&D but it did fix my issue. In addition my desktop stopped loading. I could use ctrl+alt+delete to get task manager and then use File -> Create New task to run explorer.exe. This would get my desktop back but only intermittently. Then I decided to buy Kaspersky. I was totally disappointed with it. It detected several malware but it could not cure Trojan-Clicker.win32.delf.cbe and Rootkit.win32.podnuha.a infections. It would try to delete these files, ask me to restart the computer and would not delete the files after the restart. Each time I restart the computer, it would detect these, try to delete, ask me to restart and the cycle continued. On top of the I lost my CMD and reggedit tools again. I tried to run dds.scr with the hope of getting you all the dds logs but my CMD tool does not work. In addtion whenever I tried to run 'cmd' I would lose my desktop (if I happend to get it back comehow).So instead of giving you attach.txt I can only give HT logs at this point. Hope you can help me out and I appreciate your help very much.ThanksRaj P.S : I could not attached the log... Read more

A:Trojan-Clicker.win32.delf.cbe and Rootkit.win32.podnuha.a infections

Hello! My name is Sam and I will be helping you. In order to see what's going on with your computer I will ask for you to post various logs from the tools that we will use to resolve your issue. Please also share with me any information about how your computer is reacting and behaving each step of the way as we work through this process.We need to create an OTListIt2 ReportPlease download OTListIt2 from hereSave it to your desktop.Double click on the icon on your desktop.Click the "Scan All Users" checkbox.Push the "Run Scan" button.The scan should take just a few minutes.Copy the log that opens up and paste it back here in your next reply.=============The next log will show us any hidden files that are present.Download GMER from here:Unzip it to the desktop.Open the program and click on the Rootkit tab.Make sure all the boxes on the right of the screen are checked, EXCEPT for ?Show All?.Click on Scan.When the scan has run click Copy and paste the results (if any) into this thread.

Read other 12 answers

I've been fighting agains this little menace for the last couple of days now.
No success.

I was infected through a torrent file (wasn´t cautious enough...), using AVG 9.0 paid version.
Since then I've try them all (practically), since NOD32, Kaspersky Internet Security, Malwarebytes (...) to Microsoft Security Essentials.
Kaspersky was the only one who could delete it (at least I thought so), but then my PC couldn't reboot itself, so then I was forced to restore the system and the virus was back in active!

For what it counts, I do have access to my Windows install disc.

Your specialized help is my last hope before I decide to format my Pc.
So thanks in advance for all you can do.

Read other answers

I've been fighting agains this little menace for the last couple of days now.
No success.

I was infected through a torrent file (wasn?t cautious enough...), using AVG 9.0 paid version.
Since then I've try them all (practically), since NOD32, Kaspersky Internet Security, Malwarebytes (...) to Microsoft Security Essentials.
Kaspersky was the only one who could delete it (at least I thought so), but then my PC couldn't reboot itself, so then I was forced to restore the system and the virus was back in active!

For what it counts, I do have access to my Windows install disc.

Your specialized help is my last hope before I decide to format my Pc.
So thanks in advance for all you can do.

Ark.txt and Attach.txt attached at the bottom.

Here's the DDS Scan:

DDS (Ver_09-10-13.01) - NTFSx86
Run by Zootopia at 15:23:45,52 on 23-10-2009
Internet Explorer: 8.0.7600.16385
Microsoft Windows 7 Home Premium 6.1.7600.0.1252.351.1046.18.2047.1090 [GMT 1:00]

============== Running Processes ===============

C:\Windows\system32\svchost.exe -k DcomLaunch
C:\Windows\system32\svchost.exe -k RPCSS
c:\Program Files\Microsoft Security Essentials\MsMpEng.exe
C:\Windows\System32\svchost.exe -k LocalServiceNetworkRestricted
C:\Windows\System32\svchost.exe -k LocalSystemNetworkRestricted
C:\Windows\system32\svchost.exe -k netsvcs
C:\Program Files\Creative\Shared Fi... Read more

A:VIRUS ISSUE: Rootkit.Win32.TDSS.u / Trojan:Win32/Alureon.gen!U



Read other 2 answers

I have a bad situation with my ASUS eee netbook that I'm afraid I've made worse by mucking around in files I don't understand, following different sets of directions i found on the interweb. An EPICLY Bad Idea. I know. SIGH.I hope you can help, kind soul. Windows Police Pro keeps popping up, even though I went to Task Manager and stopped it and then erased it in Add or Remove Programs under the Control Panel. I think I removed Advanced Anti-Virus too, but am not sure. When I go online I'm getting many pop-ups, an insane number. Internet Explorer opened itself when I opened Google Chrome and has set up 16 windows-- some are Windows Anti Virus Pro and a few of this: hxxp://media2.tmlatn.com/images/defaults41/approved/404.html Often the pop-up relate to things I have browsed, yep. I'm getting a TON of fake malware stoppers telling me I need their product.Sometimes the whole system freezes up, I have shut it off with the power switch several times. I have installed several Malware busters in an effort to scour my system, but they may be making it worse at this point, or maybe I downloaded a bogus one. MalwareBytes won't even run anymore. I also have Spybot and HijackThis trying to help me out. I have AVG and have run full computer scans -- each time it finds a few problems. Some of the items in the virus vault have been Win32/Cryptor, Win32/Heur, many many Trojans, including something called Rootkit-AgentDX.I did follow all the prep steps to post here, but my firewall ... Read more

A:Windows Police Pro, Win32/Cryptor, Win32/Heur, rootkit, trojans, a real mess

Hello and welcome to Bleeping ComputerWe apologize for the delay in responding to your request for help. Here at Bleeping Computer we get overwhelmed at times, and we are trying our best to keep up. Please note that your topic was not intentionally overlooked. Our mission is to help everyone in need, but sometimes it takes just a little longer to get to every request for help. No one is ignored here.If you have since resolved the original problem you were having, we would appreciate you letting us know. If not please perform the following steps below so we can have a look at the current condition of your machine. If you have not done so, include a clear description of the problems you're having, along with any steps you may have performed so far.Upon completing the steps below another staff member will review and take the steps necessary with you to get your machine back in working order clean and free of malware.If you have already posted a DDS log, please do so again, as your situation may have changed.Use the 'Add Reply' and add the new log to this thread.Thanks and again sorry for the delay.We need to see some information about what is happening in your machine. Please perform the following scan:Download DDS by sUBs from one of the following links. Save it to your desktop.DDS.scrDDS.pifDouble click on the DDS icon, allow it to run.A small box will open, with an explaination about the tool. No input is needed, the scan is running.Notepad will open with the results.Foll... Read more

Read other 10 answers

I believe that I have been infected by the following Virus: Rootkit.Agent/Gen-DNSHack; WIN32.Downloader.Small.afwj; Win32.Trojan.Dropper.VB.TR. They were all removed by either Zone Alarm Anti-Spyware and SuperAntiSpyware. However, I continue to have the symptoms: sporadic hijack of my keyboard so keystrokes are exected in what appears to be a random fashion. I say it's random because most of the time what's typed by the virus doesn't make any sese.I was working with FAX in the ZoneAlarm user forum who recomended the malware removal tools and suggested I post my Hijackthis log if all else failed. All else has failed. Following is the log. Thanks for your help.
 hijackthis.log   16.26KB
  17 downloadsLogfile of Trend Micro HijackThis v2.0.2Scan saved at 1:13:46 PM, on 6/28/2009Platform: Windows Vista SP2 (WinNT 6.00.1906)MSIE: Internet Explorer v8.00 (8.00.6001.18702)Boot mode: NormalRunning processes:C:\Program Files (x86)\Siber Systems\AI RoboForm\robotaskbaricon.exeC:\Program Files (x86)\WinZip\WZQKPICK.EXEC:\Program Files (x86)\WordWeb\wweb32.exeC:\Program Files (x86)\Hewlett-Packard\Media\DVD\DVDAgent.exeC:\Program Files (x86)\Hewlett-Packard\TouchSmart\Media\TSMAgent.exeC:\Program Files (x86)\Hewlett-Packard\TouchSmart\Media\Kernel\CLML\CLMLSvc.exeC:\Program Files (x86)\HPQ\HP Connection Manager 2�... Read more

A:Infection by Rootkit.Agent/Gen-DNSHack; WIN32.Downloader.Small.afwj; Win32.Trojan.Dropper.VB.TR

Hello and welcome to Bleeping ComputerWe apologize for the delay in responding to your request for help. Here at Bleeping Computer we get overwhelmed at times, and we are trying our best to keep up. Please note that your topic was not intentionally overlooked. Our mission is to help everyone in need, but sometimes it takes just a little longer to get to every request for help. No one is ignored here.If you have since resolved the original problem you were having, we would appreciate you letting us know. If not please perform the following steps below so we can have a look at the current condition of your machine. If you have not done so, include a clear description of the problems you're having, along with any steps you may have performed so far.Upon completing the steps below another staff member will review and take the steps necessary with you to get your machine back in working order clean and free of malware.If you have already posted a DDS log, please do so again, as your situation may have changed.Use the 'Add Reply' and add the new log to this thread.Thanks and again sorry for the delay.We need to see some information about what is happening in your machine. Please perform the following scan:We need to create an OTL ReportPlease download OTL from one of the following mirrors:This is THE MirrorSave it to your desktop.Double click on the icon on your desktop.Click the "Scan All Users" checkbox.Push the button.Two reports will open, copy and paste them in a... Read more

Read other 26 answers

Hi,It seems that I have trojan activity on my home pc.I am running Vista and when I log in to my user profile I get a blue desktop with a box saying 'Warning! Spyware detected on your computer! Install an antivirus or spyware remover to clean your computer'I have tried a few malware removal programs, Malwarebytes, CCleaner, Adaware and ran virus scans in an attemp to try and remove it myself without bothering you guys but I just can't shift it, so I'm hoping you may have the time to help?What I have noticed is that I only get these warnings when I am logged into my user profile, not as administrator or as another user on the pc. I also get no warnings when running in safe mode.I run Avast and that brings up a warning soon after the blue desktop comes up that points to infection with C:\Users\Guy\AppsData\Local\Temp\tt991.tmp.vbs. The numbers/letters after the tt (in this case 991) change each time I log in. It also states Malware Name: VBS:Malware-gen, Malware Type: Virus/Worm, VBS verison 080805-0,08/05/08 which I try and delete from the warning box.I then am greeted with a windows script host message box that will say the above file (tt991.tmp.vbs) failed (Access Denied).I also regularly get Windows security alert message boxes come up on the screen saying that Windows Firewall has detected activity of harmfull software with mention of one of many trojans. These have been:Trojan-Clicker.Win32.Tiny.hTrojan-Downloader.Win32.Agent.bqTrojan... Read more

A:Vbs:malware-gen - Trojan-clicker.win32.tiny.h, Trojan-downloader.win32.agent.bq, Trojan-spy.win32.keylogger.aa

Hi,I am hoping you can help me.My computer keeps telling me it is infected with spyware/malware. I get a blue desktop on startup with regular warnings saying the computer is infected with:Trojan-Clicker.Win32.Tiny.hTrojan-Downloader.Win32.Agent.bqTrojan-Spy.Win32.KeyLogger.aaTrojan-Spy.Win32.GreenScreenTrojan-Spy.HTML.Bankfraud.dqStrange thing is that these only show up when I log in to my user account. If I log in as administrator, another user or as any user in safe mode I get no warnings and nothing shows up on scans.The pop up warings direct me to this site: www.antispyware-review.info/?wmid=46638&pwebmid=uWfLn0pimL&a= which is Smartsoft reviews to buy PC Antispy or PC Clean pro.Malwarebytes scan picks up Fake.Dropped.Malware, Malware.Trace, Trojan.FakeAlert and Hijack.Wallpaper and even if I remove these and restart the PC they come back.A spybot scan pointed to 2 entries of VirtumondeI'll attach the latest HJT log, Malwarebytes log and Spybot logs in case you need them. Please help me with this, I cant seem to shift it Logfile of Trend Micro HijackThis v2.0.2Scan saved at 11:54:34 AM, on 8/7/2008Platform: Windows Vista SP1 (WinNT 6.00.1905)MSIE: Internet Explorer v7.00 (7.00.6001.18000)Boot mode: NormalRunning processes:C:\Windows\system32\taskeng.exeC:\Windows\system32\Dwm.exeC:\Windows\Explorer.EXEC:\Program Files\Windows Defender\MSASCui.exeC:\Windows\RtHDVCpl.exeC:\Program Files\Ado... Read more

Read other 5 answers


Thank you in advance for your assistance and volunteering your time to this forum. I received some nasty malware when I inserted a client’s flash drive into my PC. Avast popped up immediately and identified Win32: Trojan-gen. However, as soon as this occurred, my PC has been almost unusable and Avast regularly says that my machine is under attack by Win32:Rootkit-gen and Win32: Trojan-gen. Windows runs very slowly, I cannot shut down my computer without a hard reboot, I can open Firefox and use the internet, but as soon as I close the browser, windows locks up (times out forever and nothing responds) and I have to hard reboot. If you could offer any assistance it would be greatly appreciated as my machine is next to useless at the moment!

Below is my Hijackthis log:

Logfile of Trend Micro HijackThis v2.0.2
Scan saved at 8:28:05 AM, on 1/9/2009
Platform: Windows XP SP3 (WinNT 5.01.2600)
MSIE: Internet Explorer v7.00 (7.00.6000.16705)
Boot mode: Normal

Running processes:
C:\Program Files\WIDCOMM\Bluetooth Software\bin\btwdins.exe
C:\Program Files\Alwil Software\Avast4\aswUpdSv.exe
C:\Program Files\Alwil Software\Avast4\ashServ.exe
C:\Program Files\Intel\AMT\atchksrv.exe
C:\Program Files\LANDesk\Shared Files\residentagent.exe
C:\Program Files\LAND... Read more

A:Need Assistance Removing Win32:Rootkit-gen and Win32: Trojan-gen - Thank You!

Bump. Thank you!

Read other 2 answers

Started having popups on my wife's laptop so I ran a scan with Avast and it detected win32:rootkit-gen[rtk].
I used Avast to try and get rid of win32:rootkit-gen[rtk] and it said it was successful.
I ran another scan and now there are about a dozen files with win32:webcake-a[adw].
I am currently running a boot scan with Avast.
The operating system is windows 8.
Any help would be appreciated.

A:Avast found win32:rootkit-gen[rtk] now I have win32:webcake-a [adw]

Hi BoneFish -win32:rootkit-gen[rtk] seems to be a favorite of avast! Antivirus (I assume you have avast! installed) -  While this program runs see How To Temporarily Disable Your Anti-virusScan your machine with ESET OnlineScanThis is best done with Internet Explorer as it uses Active X to download -Directions for alternate browsers are included if you do not use Internet Explorer1. Hold down Control and click HERE to open ESET OnlineScan in a new window.2. Click the ESET Online Scanner button.3. NOTE :.For alternate browsers only: (Microsoft Internet Explorer users can skip these steps)  - 1. Click on esetsmartinstaller_enu.exe to download the ESET Smart Installer. Save it to your desktop.- 2. Double click on the ESET Online Scanner icon on your desktop.  4. Check "YES, I accept the Terms of Use." 5. Click the Start button. 6. Accept any security warnings from your browser. 7. Under scan settings, check "Scan Archives" and "Remove found threats"8. Click "Advanced settings" and select the following:Scan potentially unwanted applications (PUPs)Scan for potentially unsafe applicationsEnable Anti-Stealth technology 9. ESET will then download updates for itself, install itself, and begin scanning your computer. Please be patient as this will take some time to download the program for a first time, and then download updated data base (1 to 2  hours is not unusual)10. When the scan completes, click List Threats11. Click Export, and ... Read more

Read other 12 answers