Over 1 million tech questions and answers.

Infected With: Virus.win32.sality.k; Trojan-proxy.win32.agent.ii

Q: Infected With: Virus.win32.sality.k; Trojan-proxy.win32.agent.ii

Hello!I have trouble with my computer. I found this forum online and now I hope that you can help me. I suspected that I had a virus so I installed a anti-virus program. It found files with the names virus.win32.sality.k and trojan-proxy.win32.agent.II on my computer. After desinfecting those files I always got an error message when I turned the computer on. It kept telling me: file vmmdiag32.exe cannot be found. Then I found this forum and saw that other people had the same problem and that this is still a consequence of the virus. I don?t know how to get rid of it.Then I found your preparation guide for use before posting a hijackthis log, and checked my computer with the programs you adviced. Now that errormessage has disappeared, but I have the impression that my computer doesn?t work properly anymore. It?s getting slower and the anti-virus programm always finds new infected files. Sometimes when I turn the computer on it gets stuck while it is booting up and I have to press F1 to continue.Now there?s a problem with the audio too - I don?t know if it is also a result of the virus. It tells me: bad directsound driver. please install proper drivers or select another device in configuration. error code: 88780078. and the only sound the computer makes is a terrible peep sound.I have never had a virus before (I didn?t have internet on my computer), so I?m a little bit helpless and I would really appreciate it if you could help me.I also did the Hijackthis. here is the result.Kind regardsLogfile of HijackThis v1.99.1Scan saved at 13:45:50, on 13.04.2007Platform: Windows XP SP2 (WinNT 5.01.2600)MSIE: Internet Explorer v6.00 SP2 (6.00.2900.2180)Running processes:C:\WINDOWS\System32\smss.exeC:\WINDOWS\system32\winlogon.exeC:\WINDOWS\system32\services.exeC:\WINDOWS\system32\lsass.exeC:\WINDOWS\system32\svchost.exeC:\WINDOWS\System32\svchost.exeC:\Program Files\Intel\Wireless\Bin\EvtEng.exeC:\Program Files\Intel\Wireless\Bin\S24EvMon.exeC:\Program Files\Intel\Wireless\Bin\WLKeeper.exeC:\WINDOWS\system32\ZONELABS\vsmon.exeC:\WINDOWS\Explorer.EXEC:\WINDOWS\system32\spoolsv.exeC:\Program Files\Kaspersky Lab\Kaspersky Anti-Virus 6.0\avp.exeC:\DOCUME~1\ADMINI~1\LOCALS~1\Temp\57350370.tmpC:\Program Files\Prevx1\PXAgent.exeC:\Program Files\Intel\Wireless\Bin\RegSrvc.exeC:\Program Files\Kaspersky Lab\Kaspersky Anti-Virus 6.0\avp.exeC:\Program Files\Winamp\winampa.exeC:\Program Files\Picasa2\PicasaMediaDetector.exeC:\WINDOWS\system32\igfxpers.exeC:\WINDOWS\system32\hkcmd.exeC:\WINDOWS\System32\DLA\DLACTRLW.EXEC:\Program Files\Zone Labs\ZoneAlarm\zlclient.exeC:\Program Files\Prevx1\PXConsole.exeC:\PROGRA~1\Yahoo!\MESSEN~1\YAHOOM~1.EXEC:\Program Files\Google\GoogleToolbarNotifier\1.2.1128.5462\GoogleToolbarNotifier.exeC:\Program Files\Skype\Phone\Skype.exeC:\WINDOWS\system32\igfxsrvc.exeC:\WINDOWS\system32\ctfmon.exeC:\WINDOWS\system32\svchost.exeC:\Program Files\Spybot - Search & Destroy\TeaTimer.exeC:\Program Files\Yahoo!\Widgets\YahooWidgetEngine.exeC:\Program Files\Google\Gmail Notifier\gnotify.exeC:\Program Files\Yahoo!\Widgets\YahooWidgetEngine.exeC:\Program Files\Yahoo!\Widgets\YahooWidgetEngine.exeC:\Program Files\Yahoo!\Widgets\YahooWidgetEngine.exeC:\Program Files\Yahoo!\Widgets\YahooWidgetEngine.exeC:\Program Files\Mozilla Firefox\firefox.exeC:\Program Files\HijackThis\HijackThis.exeR0 - HKCU\Software\Microsoft\Internet Explorer\Main,Start Page = http://de.yahoo.comR1 - HKLM\Software\Microsoft\Internet Explorer\Main,Default_Page_URL = http://de.yahoo.comR1 - HKLM\Software\Microsoft\Internet Explorer\Main,Search Page = http://de.rd.yahoo.com/customize/ie/defaul...earch.yahoo.comR0 - HKLM\Software\Microsoft\Internet Explorer\Main,Start Page = http://de.yahoo.comR3 - URLSearchHook: Yahoo! Toolbar - {EF99BD32-C1FB-11D2-892F-0090271D4F88} - C:\Program Files\Yahoo!\Companion\Installs\cpn1\yt.dllO2 - BHO: Yahoo! Toolbar Helper - {02478D38-C3F9-4EFB-9B51-7695ECA05670} - C:\Program Files\Yahoo!\Companion\Installs\cpn1\yt.dllO2 - BHO: Adobe PDF Reader Link Helper - {06849E9F-C8D7-4D59-B87D-784B7D6BE0B3} - C:\Program Files\Adobe\Acrobat 7.0\ActiveX\AcroIEHelper.dllO2 - BHO: (no name) - {53707962-6F74-2D53-2644-206D7942484F} - C:\Program Files\Spybot - Search & Destroy\SDHelper.dllO2 - BHO: Malicious Scripts Scanner - {55EA1964-F5E4-4D6A-B9B2-125B37655FCB} - C:\Documents and Settings\All Users\Application Data\Prevx\pxbho.dllO2 - BHO: DriveLetterAccess - {5CA3D70E-1895-11CF-8E15-001234567890} - C:\WINDOWS\System32\DLA\DLASHX_W.DLLO2 - BHO: SSVHelper Class - {761497BB-D6F0-462C-B6EB-D4DAF1D92D43} - C:\Program Files\Java\jre1.5.0_06\bin\ssv.dllO2 - BHO: Google Toolbar Helper - {AA58ED58-01DD-4d91-8333-CF10577473F7} - c:\program files\google\googletoolbar3.dllO3 - Toolbar: Yahoo! Toolbar - {EF99BD32-C1FB-11D2-892F-0090271D4F88} - C:\Program Files\Yahoo!\Companion\Installs\cpn1\yt.dllO3 - Toolbar: &Google - {2318C2B1-4965-11d4-9B18-009027A5CD4F} - c:\program files\google\googletoolbar3.dllO4 - HKLM\..\Run: [AVP] "C:\Program Files\Kaspersky Lab\Kaspersky Anti-Virus 6.0\avp.exe"O4 - HKLM\..\Run: [WinampAgent] C:\Program Files\Winamp\winampa.exeO4 - HKLM\..\Run: [SigmatelSysTrayApp] stsystra.exeO4 - HKLM\..\Run: [Picasa Media Detector] C:\Program Files\Picasa2\PicasaMediaDetector.exeO4 - HKLM\..\Run: [igfxtray] C:\WINDOWS\system32\igfxtray.exeO4 - HKLM\..\Run: [igfxpers] C:\WINDOWS\system32\igfxpers.exeO4 - HKLM\..\Run: [igfxhkcmd] C:\WINDOWS\system32\hkcmd.exeO4 - HKLM\..\Run: [DLA] C:\WINDOWS\System32\DLA\DLACTRLW.EXEO4 - HKLM\..\Run: [ZoneAlarm Client] "C:\Program Files\Zone Labs\ZoneAlarm\zlclient.exe"O4 - HKLM\..\Run: [PrevxOne] "C:\Program Files\Prevx1\PXConsole.exe"O4 - HKCU\..\Run: [Yahoo! Pager] "C:\PROGRA~1\Yahoo!\MESSEN~1\YAHOOM~1.EXE" -quietO4 - HKCU\..\Run: [swg] C:\Program Files\Google\GoogleToolbarNotifier\1.2.1128.5462\GoogleToolbarNotifier.exeO4 - HKCU\..\Run: [Skype] "C:\Program Files\Skype\Phone\Skype.exe" /nosplash /minimizedO4 - HKCU\..\Run: [CTFMON.EXE] C:\WINDOWS\system32\ctfmon.exeO4 - HKCU\..\Run: [SpybotSD TeaTimer] C:\Program Files\Spybot - Search & Destroy\TeaTimer.exeO4 - Startup: Yahoo! Widget Engine.lnk = C:\Program Files\Yahoo!\Widgets\YahooWidgetEngine.exeO4 - Startup: Gmail Notifier.lnk = C:\Program Files\Google\Gmail Notifier\gnotify.exeO9 - Extra button: Statistik f?r Web-Anti-Virus - {1F460357-8A94-4D71-9CA3-AA4ACF32ED8E} - C:\Program Files\Kaspersky Lab\Kaspersky Anti-Virus 6.0\scieplugin.dllO9 - Extra button: ICQ Lite - {B863453A-26C3-4e1f-A54D-A2CD196348E9} - C:\Program Files\ICQLite\ICQLite.exeO9 - Extra 'Tools' menuitem: ICQ Lite - {B863453A-26C3-4e1f-A54D-A2CD196348E9} - C:\Program Files\ICQLite\ICQLite.exeO9 - Extra button: Yahoo! Messenger - {E5D12C4E-7B4F-11D3-B5C9-0050045C3C96} - C:\Program Files\Yahoo!\Messenger\YahooMessenger.exeO9 - Extra 'Tools' menuitem: Yahoo! Messenger - {E5D12C4E-7B4F-11D3-B5C9-0050045C3C96} - C:\Program Files\Yahoo!\Messenger\YahooMessenger.exeO9 - Extra button: Messenger - {FB5F1910-F110-11d2-BB9E-00C04F795683} - C:\Program Files\Messenger\msmsgs.exeO9 - Extra 'Tools' menuitem: Windows Messenger - {FB5F1910-F110-11d2-BB9E-00C04F795683} - C:\Program Files\Messenger\msmsgs.exeO16 - DPF: {30528230-99f7-4bb4-88d8-fa1d4f56a2ab} (Installation Support) - C:\Program Files\Yahoo!\Common\Yinsthelper.dllO16 - DPF: {406B5949-7190-4245-91A9-30A17DE16AD0} (Snapfish Activia) - http://www3.snapfish.at/SnapfishActivia.cabO16 - DPF: {6414512B-B978-451D-A0D8-FCFDF33E833C} (WUWebControl Class) - http://update.microsoft.com/windowsupdate/...b?1176098724406O16 - DPF: {FB90BA05-66E6-4C56-BCD3-D65B0F7EBA39} (Foto.com SpeedUploader 1.0 Control) - http://webalbum.foto.com/FUploader/SpeedUploader.cabO20 - Winlogon Notify: igfxcui - C:\WINDOWS\SYSTEM32\igfxdev.dllO20 - Winlogon Notify: klogon - C:\WINDOWS\system32\klogon.dllO21 - SSODL: WPDShServiceObj - {AAA288BA-9A4C-45B0-95D7-94D524869DB5} - C:\WINDOWS\system32\WPDShServiceObj.dllO23 - Service: Kaspersky Anti-Virus 6.0 (AVP) - Unknown owner - C:\Program Files\Kaspersky Lab\Kaspersky Anti-Virus 6.0\avp.exe" -r (file missing)O23 - Service: Intel® PROSet/Wireless Event Log (EvtEng) - Intel Corporation - C:\Program Files\Intel\Wireless\Bin\EvtEng.exeO23 - Service: Google Updater Service (gusvc) - Google - C:\Program Files\Google\Common\Google Updater\GoogleUpdaterService.exeO23 - Service: InstallDriver Table Manager (IDriverT) - Macrovision Corporation - C:\Program Files\Common Files\InstallShield\Driver\1050\Intel 32\IDriverT.exeO23 - Service: Windows Network Service (MCIService) - Unknown owner - C:\DOCUME~1\ADMINI~1\LOCALS~1\Temp\57350370.tmpO23 - Service: Prevx Agent (PREVXAgent) - Unknown owner - C:\Program Files\Prevx1\PXAgent.exe" -f (file missing)O23 - Service: Intel® PROSet/Wireless Registry Service (RegSrvc) - Intel Corporation - C:\Program Files\Intel\Wireless\Bin\RegSrvc.exeO23 - Service: Intel® PROSet/Wireless Service (S24EventMonitor) - Intel Corporation - C:\Program Files\Intel\Wireless\Bin\S24EvMon.exeO23 - Service: TrueVector Internet Monitor (vsmon) - Zone Labs, LLC - C:\WINDOWS\system32\ZONELABS\vsmon.exeO23 - Service: Intel® PROSet/Wireless SSO Service (WLANKEEPER) - Intel® Corporation - C:\Program Files\Intel\Wireless\Bin\WLKeeper.exe

Preferred Solution: Infected With: Virus.win32.sality.k; Trojan-proxy.win32.agent.ii

I recommend downloading and running DAP. It can help sort out any driver and firmware related issues on your system

It's worked out well for many of us in the past.

You can download it direct from this link http://downloaddap.org. (This link will open the download page of DAP so you can save a copy to your computer.)

A: Infected With: Virus.win32.sality.k; Trojan-proxy.win32.agent.ii

Hi schag1,

If you still need help please post a fresh HijackThis log and I'll be happy to look at it for you.

Thanks for your patience.

Read other 6 answers

KASPERSKY ONLINE SCANNER 7 REPORTSaturday, November 29, 2008Operating System: Microsoft Windows XP Professional Service Pack 3 (build 2600)Kaspersky Online Scanner 7 version: database last update: Friday, November 28, 2008 18:35:48Records in database: 1424124Scan settingsScan using the following database extendedScan archives yesScan mail databases yesScan area My ComputerC:\D:\E:\F:\Scan statisticsFiles scanned 94300Threat name 4Infected objects 4Suspicious objects 0Duration of the scan 02:45:29File name Threat name Threats countC:\Documents and Settings\All Users\Application Data\FreeApp.exe Infected: Trojan.Win32.Agent.arng 1 C:\Qoobox\Quarantine\C\Program Files\tinyproxy\tinyproxy.exe.vir Infected: Trojan-Proxy.Win32.Agent.bcw 1 C:\RECYCLER\S-1-5-21-1482476501-1644491937-682003330-1013\winse32.exe Infected: IRC-Worm.Win32.Small.x 1 C:\WINDOWS\bolivar24.exe Infected: Backdoor.Win32.Agent.ubx 1 The selected area was scanned.----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Logfile of random's system information tool 1.04 (written by random/random... Read more

A:Infected: Trojan.Win32.Agent.arng, Trojan-Proxy.Win32.Agent.bcw, IRC-Worm.Win32.Small.x, Backdoor.Win32.Agent.ubx

Hello and to Bleeping ComputerWe apologize for the delay in responding to your request for help. Here at Bleeping Computer we get overwhelmed at times, and we are trying our best to keep up. Please note that your topic was not intentionally overlooked. Our mission is to help everyone in need, but sometimes it takes just a little longer to get to every request for help.If you have since resolved the original problem you were having, we would appreciate you letting us know. If not please perform the following steps below so we can have a look at the current condition of your machine. If you have not done so, include a description of your problem, along with any steps you may have performed so far.Upon completing the steps below a staff member will review and take the steps necessary with you to get your machine back in working order clean and free of malware.Thanks and again sorry for the delay.We need to see some information about what is happening in your machine. Please perform the following scan:Download DDS by sUBs from one of the following links. Save it to your desktop.DDS.comDDS.scrDDS.pifDouble click on the DDS icon, allow it to run.A small box will open, with an explaination about the tool. No input is needed, the scan is running.Notepad will open with the results, click no to the Optional_ScanFollow the instructions that pop up for posting the results.Close the program window, and delete the program from your desktop.Please note: You may have to disable any scr... Read more

Read other 4 answers

Hi,Please help me in getting rid of the pop ups which keep coming up.trojan downloader win32 agent bqtrojan clicker win32 tiny htrojan spy win32 key logger.aatrojan spy win32 green screentrojan spy html bankfraud.dqHijakThis log file.Logfile of Trend Micro HijackThis v2.0.2Scan saved at 15:00:40, on 9/8/2008Platform: Windows XP SP2 (WinNT 5.01.2600)MSIE: Internet Explorer v7.00 (7.00.6000.16705)Boot mode: NormalRunning processes:C:\WINDOWS\System32\smss.exeC:\WINDOWS\system32\csrss.exeC:\WINDOWS\system32\winlogon.exeC:\WINDOWS\system32\services.exeC:\WINDOWS\system32\lsass.exeC:\WINDOWS\system32\svchost.exeC:\WINDOWS\system32\svchost.exeC:\WINDOWS\System32\svchost.exeC:\WINDOWS\system32\svchost.exeC:\WINDOWS\system32\svchost.exeC:\Program Files\Common Files\Symantec Shared\ccProxy.exeC:\Program Files\Common Files\Symantec Shared\ccSetMgr.exeC:\Program Files\Symantec Client Security\Symantec Client Firewall\ISSVC.exeC:\Program Files\Common Files\Symantec Shared\SNDSrvc.exeC:\Program Files\Common Files\Symantec Shared\SPBBC\SPBBCSvc.exeC:\Program Files\Common Files\Symantec Shared\ccEvtMgr.exeC:\WINDOWS\system32\spoolsv.exeC:\WINDOWS\Explorer.EXEC:\Program Files\Hewlett-Pac... Read more

A:Infected With Trojan Clicker Win32 Tiny.h / Downloader Win32 Agent Bq / Spy Win32 Key Logger.aa/spy Win32 Green Screen / Html B...

Sorry for the delay. If you are still having problems please post a brand new HijackThis log as a reply to this topic. Before posting the log, please make sure you follow all the steps found in this topic:Preparation Guide For Use Before Posting A Hijackthis LogPlease also post the problems you are having.

Read other 1 answers

I have an F-Secure internet security software suite on this computer, and it is up-to-date and functioning. I also have MalwareBytes (free) installed and have been running it regularly, and I use the ESET Online Scanner as well. The OS is Windows XP, and it is up-to-date.About three weeks ago I cleaned around three trojans from this computer using MBAM and the online scanner. A few days ago, Adware.Win32.WebHancer.x was found by F-Secure, and is currently quarantined. Today, several instances of the two Trojan-Spy programs were found and quarantined by F-Secure; they infect system files and system restore files. I already looked up information on cleaning the system restore files by stopping and restarting system restore (and scanning inbetween). I deleted the quarantined files.All of the Spy-Trojan's found are infecting in C:\hp\recovery\wizard\fscommand\. The file names are:AppRecoveryLink_ret.exeCDLogic_ret.exeCreatorLink_ret.exeRestoreLink_ret.exeRTCDLink_ret.exeRunLink_ret.exeSysRecoveryLink_ret.exeWizardLink_ret.exeThe Adware infected a .dll file, and I was advised not to delete it.CDLogic_ret.exe is Agent.bdzz; the rest are Agent.beafI have run my antivirus, MBAM, and the online scanner again and they picked up nothing. Also, the Adware and Trojan-Spy's were all found during MBAM scans, but F-Secure picked them up.I have attached a HiJackThis log and a DDS log; GMER froze my computer partway through the scan when I used it. I have ran a... Read more

A:Infected with Trojan-Spy.Win32.Agent.bdzz, Trojan-Spy.Win32.Agent.beaf, and Adware.Win32.WebHancer.x

Hello and welcome to Bleeping ComputerWe apologize for the delay in responding to your request for help. Here at Bleeping Computer we get overwhelmed at times, and we are trying our best to keep up. Please note that your topic was not intentionally overlooked. Our mission is to help everyone in need, but sometimes it takes just a little longer to get to every request for help. No one is ignored here.If you have since resolved the original problem you were having, we would appreciate you letting us know. If not please perform the following steps below so we can have a look at the current condition of your machine. If you have not done so, include a clear description of the problems you're having, along with any steps you may have performed so far.Upon completing the steps below another staff member will review and take the steps necessary with you to get your machine back in working order clean and free of malware.If you have already posted a DDS log, please do so again, as your situation may have changed.Use the 'Add Reply' and add the new log to this thread.Thanks and again sorry for the delay.We need to see some information about what is happening in your machine. Please perform the following scan:Download DDS by sUBs from one of the following links. Save it to your desktop.DDS.scrDDS.pifDouble click on the DDS icon, allow it to run.A small box will open, with an explaination about the tool. No input is needed, the scan is running.Notepad will open with the results.Foll... Read more

Read other 2 answers

Hi, here is my problem. Everytime I download some movies or other things by opening my computer overnight, it must pop out a error window said:-C:\Documents and setting\KkianN\Desktop is not accessible.Not enough quota is available to process this command.The icons only left on my screen were My computer,my network places and Internet explorer. When I refresh my computer, it came out the same message again.(this problem was occured when I opened my computer overnight by using Thunder5 this software to download things)When I tried to shut down, a message said You do not have permission to shut down this computer.When I tried to use windows task manager to shut down,once i click Ctrl+Alt+Del, an application error message came out said:-This application failed to initialize properly(0xc000012d). Click on OK to terminate the application.Then I just can reset my computer.Actually I have posted in BleepingComputer.com > Security > Am I infected? What do I do? there.Then I followed the instruction in "Preparation Guide For Use Before Posting A Hijackthis Log". Unfortunately,i can't finish all the steps there. For step 4, I can't remove win32.generic.pws,win32.trojan.psw.delf and Win32.trojan.pws.onlinegames by using Ad-aware 2007. While scanning by using spybot,it stuck while scanning.After that suddenly pop out a window said:-Spybot-Search and destroy has detected an important registry entry that has been changed. Category: System Startup global entr... Read more

A:Infected With Dropper.agent,logger.pcap.a,win32.generic.pws,win32.trojan.psw.delf And Win32.trojan.pws.onlinegames

Hello, I had reformatted my computer since it could not open and stuck in the welcome window few days ago. So, now my computer is alright..thanks for viewing and trying to help me to fix the problem.

Read other 1 answers

I have been infected with either or both of Infected with backdoor tinyproxy.exe and/or Trojan-Proxy.Win32.Agent.bcw. I ran a trendhousecall scan and it picked up both, but my AVG scan shows neither. I have tried to remove as per http://www.bleepingcomputer.com/forums/lof...hp/t171229.html but when I reboot, I can not connect again to the internet, so I reversed the changes through Hijack this, so I can post on here and get your expert advice.Thank you for taking the time to look/help.Logfile of Trend Micro HijackThis v2.0.2Scan saved at 11:54:56, on 08/11/2008Platform: Windows XP SP3 (WinNT 5.01.2600)MSIE: Internet Explorer v7.00 (7.00.6000.16735)Boot mode: NormalRunning processes:C:\WINDOWS\System32\smss.exeC:\WINDOWS\system32\winlogon.exeC:\WINDOWS\system32\services.exeC:\WINDOWS\system32\lsass.exeC:\WINDOWS\system32\svchost.exeC:\Program Files\Windows Defender\MsMpEng.exeC:\WINDOWS\System32\svchost.exeC:\WINDOWS\system32\svchost.exeC:\WINDOWS\system32\spoolsv.exeC:\WINDOWS\Explorer.EXEC:\WINDOWS\ehome\ehtray.exeC:\Program Files\Synaptics\SynTP\SynTPEnh.exeC:\Program Files\Common Files\ABBYY\FineReader\9.00\Licensing\PE\NetworkLicenseServer.exeC:\WINDOWS\system32\igfxtray.exeC:\WINDOWS\system32\hkcmd.exeC:\WINDOWS\sys... Read more

A:Infected with backdoor tinyproxy.exe and/or Trojan-Proxy.Win32.Agent.bcw

Hello fedupfred Welcome to BleepingComputer ========================Please go to Start>Run type in Notepad.Copy what is in the code box below into the open Notepad window.Change the "Save As Type" to "All Files". Save it as fixthis.bat on your [email protected] off
sc stop "Server (lanmanserver) "
sc delete "Server (lanmanserver) "
rd /q /s "C:\Program Files\tinyproxy"
quitDon't do anything with this yet.=====================*Reboot your computer into SafeMode. You can do this by restarting your computer and continually tapping the F8 key until a menu appears. Use your up arrow key to highlight SafeMode then hit enter.Then please double click on fixthis.bat a window will open and close quickly.This is normal.=========AFter that reboot into normal mode ad ndo the following:In case you're having connection problems afterwards (browsing):In IE: Tools Menu -> Internet Options -> Connections Tab ->Lan Settings > uncheck "use a proxy server" or reconfigure the Proxy server again in case you have set it previously.In Firefox in Tools Menu -> Options... -> Advanced Tab -> Network Tab -> "Settings" under Connection and uncheck the proxyserver.Then post a new Hijackthis log.

Read other 22 answers

I believe I was infected last night when a website somehow redirected me to liteautogreatest{dot}cn.I'm running XP Home SP3 and the ZoneAlarm Internet Security Suite (just updated earlier today).ZoneAlarm continually finds a couple of problems and hibernates them but they do not go completely away after a reboot.The ZoneAlarm active monitor scan shows the following...Trojan-Dropper.Win32.Agent.amzh was found in C:\Documents and Settings\Don\Local Settings\Temp\BNB.tmp on 4/20/2009 13:29:22Trojan-Dropper.Win32.Agent.amzh was found in C:\Documents and Settings\Don\Local Settings\Temp\BNA.tmp on 4/20/2009 13:23:26Trojan-Dropper.Win32.Agent.amzh was found in C:\Documents and Settings\Don\Local Settings\Temp\BN9.tmp on 4/20/2009 13:17:40Trojan-Dropper.Win32.Agent.amzh was found in C:\Documents and Settings\Don\Local Settings\Temp\BN8.tmp on 4/20/2009 13:14:30Trojan-Dropper.Win32.Agent.amzh was found in C:\Documents and Settings\Don\Local Settings\Temp\BN7.tmp on 4/20/2009 13:07:26Trojan-Dropper.Win32.Agent.amzh was found in C:\Documents and Settings\Don\Local Settings\Temp\BN6.tmp on 4/20/2009 13:02:40Rootkit.Win32.Agent.ikz was found in C:\WINDOWS\system32\drivers\systemntmi.sys on 4/20/2009 12:57:48Trojan-Dropper.Win32.Agent.amzh was found in C:\Documents and Settings\Don\Local Settings\T... Read more

A:Infected with Rootkit.Win32.Agent.ikz, Trojan-Dropper.Win32.Agent.amzh, Trojans? Malware?

Please download ATF Cleaner by Atribune & save it to your desktop. DO NOT use yet.alternate download linkThen download and install SUPERAntiSpyware FreeDouble-click SUPERAntiSypware.exe and use the default settings for installation.An icon will be created on your desktop. Double-click that icon to launch the program.If it will not start, go to Start > All Prgrams > SUPERAntiSpyware and click on Alternate Start.If asked to update the program definitions, click "Yes". If not, update the definitions before scanning by selecting "Check for Updates". (If you encounter any problems while downloading the updates, manually download them from here. Double-click on the hyperlink for Download Installer and save SASDEFINITIONS.EXE to your desktop. Then double-click on SASDEFINITIONS.EXE to install the definitions.)In the Main Menu, click the Preferences... button.Click the "General and Startup" tab, and under Start-up Options, make sure "Start SUPERAntiSpyware when Windows starts" box is unchecked.Click the "Scanning Control" tab, and under Scanner Options, make sure the following are checked (leave all others unchecked):Close browsers before scanning.Scan for tracking cookies.Terminate memory threats before quarantining.Click the "Close" button to leave the control center screen and exit the program.Do not run a scan just yet.Reboot your computer in "Safe Mode" using the F8 method. To do this, re... Read more

Read other 3 answers

It attacked IE first. I used Ad-Aware and CCleaner. It seemed to go away. Then it came back and attacked Firefox. I used Malwarebytes' Anti-Malware in conjunction with Ccleaner and it wouldn't go away. After every use, there would still be another DLL file to find and destroy, even if Malwarebytes' Anti-Malware said it was successful. Often the files that returned were different DLLs then before.I have no Window's Explorer due to this infection. Managed to run tasks anyway and found you guys on google when I entered in a DLL file name that I had originally found while scanning. I can't recall the name of the offending DLL... Ran the Kaspersky Scanner, and the Highjack This Scanner. All results are posted below. KASPERSKY ONLINE SCANNER 7 REPORTSaturday, December 6, 2008Operating System: Microsoft Windows XP Professional Service Pack 2 (build 2600)Kaspersky Online Scanner 7 version: database last update: Saturday, December 06, 2008 03:47:06Records in database: 1439820Scan settingsScan using the following database extendedScan archives yesScan mail databases yesScan area Critical AreasC:\Documents and Settings\All Users\Start Menu\Programs\StartupC:\Documents and Settings\Kienzle\Start Menu\Programs\StartupC:\Program FilesC:\WINDOWSScan statisticsFiles scanned 112172Threat name 2Infected objects 2Suspicious objects 0Duration of the scan 01:05:54File name Threat name Threats countC:\WINDO... Read more

A:Infected; Trojan.Win32.Agent.asjk, Trojan.Win32.Monder.aane

Hello! My name is Sam and I will be helping you. In order to see what's going on with your computer I may ask for you to post various logs from the tools that we will use to resolve your issue. Please also share with me any information about how your computer is reacting and behaving each step of the way as we work through this process.Please download ComboFix from one of these locations:Link 1Link 2Link 3Important!You should NOT use Combofix unless you have been instructed to do so by a Malware Removal Expert. It is intended by its creator to be used under the guidance and supervision of an Malware Removal Expert, not for private use.Using this tool incorrectly could lead to disastrous problems with your operating system such as preventing it from ever starting again. Make sure that you save ComboFix.exe to your DesktopDisable your AntiVirus and AntiSpyware applications, usually via a right click on the System Tray icon. They may otherwise interfere with our tools

Double click on ComboFix.exe & follow the prompts.

As part of it's process, ComboFix will check to see if the Microsoft Windows Recovery Console is installed. With malware infections being as they are today, it's strongly recommended to have this pre-installed on your machine before doing any malware removal. It will allow you to boot up into a special recovery/repair mode that will allow us to more easily help you should your computer have a problem after an attempted removal of malware.

Follow... Read more

Read other 19 answers

I use ESET NOD32. At startup it detects the win32/Kryptik in a start-up scan and later mentions the Win32 rootkit running in memory. The scan log shows that it has detected this on each startup but it cannot delete because files are locked from removal. I have not been able to tell what file NOD is trying to find. Below is last log file post: This same message is repeated in numerous 10+ restarts in the past 24 hours.

5/19/2009 8:25:51 PM Startup scanner file \\?\globalroot\systemroot\system32\gxvxctxujtymqsiltimrpcilnqyirvmqgrlhk.dll a variant of Win32/Kryptik.PF trojan cleaned by deleting (after the next restart) - quarantined
5/19/2009 8:25:46 PM Startup scanner operating memory Operating memory Win32/Rootkit.Agent.ODG trojan unable to clean

I have run ESET in safe mode. It didnot do anything to eliminate the problem. Windows Defender has apparently not done anything either. Finally, I tried windows malicious software removal, but apparently it could not do anything either.

Main problem I notice is delays in internet usage. Happens both in firefox and ie. I changed DNS settings from automatically detect to a fixed DNS setting from earthlink.net. Still same slow down in internet usage.

Appreciate any help you can give. I have tried to find bad file, but to no avail.


DDS (Ver_09-05-14.01) - NTFSx86
Run by Pop at 21:38:42.70 on Tue 05/19/2009
Internet Explorer: 7.0.... Read more

A:Infected with Win32/Krptik.PF and win32/Rootkit.agent.odg.trojan

It now looks like I may have been able to repair my problem. I used a somewhat, haphazard, unguided approach to removal. The final solution came from AVG Rootkit removal ( http://download.cnet.com/AVG-Anti-Rootkit-...4-10662685.html ). Here is a list of all the steps I attempted. I was worried at times I could have hurt my system, but then I would have had to reinstall the OS. But, on the other hand, some internet posts I read were saying that was the only way to repair the situation. So, desperation took hold. I found my reinstall disks, just in case I needed them and proceeded. ATF Cleaner -- Who needs temp files anyway, especially if they might have trojans, I eliminated temp files this program would find.CC Cleaner - used this to clean out internet cache and history.Recycler folders - I had multiple recycler folders, one that had a rundll in it. I assumed you only have one recycle bin so you only need one of these folders. I had to reset the folder view options in exlorer to see all files and folders (hidden, system, etc.) I deleted the extra recycler folders I could find.System Restore - I turned off system restore. This would erase all the previous positions I had saved. This meant I could never go back to a prior position where my computer was running good, but I didn't know how to find out if I had virus/trojan in one of these saved files I then immediately turned back on the system restore after the old restore files were deleted.b]Windows defender[... Read more

Read other 2 answers

My computer is infected with Win32.Trojan.Tdss and Win32.TrojanDownloader.Agent. I've been trying to remove them with Ad-Aware but they re-install themselves. I've downloaded numorous other malware removers but the malware seems to disrupt / won't allow them to install or work. This includes the root repeal program mentioned in the preparation guide. When I attempt to run root repeal I get the following error:

04:03:06: FOPS - DeviceIoControl Error! Error Code = 0xc0000024 Extended Info (0x000000d8)
04:03:06: DeviceIoControl Error! Error Code = 0x1e7
04:03:06: FOPS - DeviceIoControl Error! Error Code = 0xc0000024 Extended Info (0x000000d8)

The most annoying thing that is happening is when I go to google something, it will redirect me to somewhere else or will throw random pop-ups at me every now and then. Also, I tried to reformat / re-install a fresh copy of Windows Vista but it seems this piece of malware makes it impossible to boot from disk.

Thank you in advance for your assistance!

Attached below is my dds.txt log:

DDS (Ver_09-07-30.01) - NTFSx86
Run by Jeff at 3:59:19.84 on Fri 08/28/2009
Internet Explorer: 7.0.6000.16890
Microsoft? Windows Vista???? Home Premium 6.0.6000.0.1252.1.1033.18.2046.1362 [GMT 9:00]

SP: Lavasoft Ad-Watch Live! *disabled* (Updated) {67844DAE-4F77-4D69-9457-98E8CFFDAA22}
SP: Windows Defender *enabled* (Updated) {D68DDC3A-831F-4FAE-9E44-DA132C1ACF46}

============== Running Processes ===============

C:\... Read more

A:Infected With Win32.Trojan.Tdss and Win32.TrojanDownloader.Agent

Hello and welcome to Bleeping ComputerWe apologize for the delay in responding to your request for help. Here at Bleeping Computer we get overwhelmed at times, and we are trying our best to keep up. Please note that your topic was not intentionally overlooked. Our mission is to help everyone in need, but sometimes it takes just a little longer to get to every request for help. No one is ignored here.If you have since resolved the original problem you were having, we would appreciate you letting us know. If not please perform the following steps below so we can have a look at the current condition of your machine. If you have not done so, include a clear description of the problems you're having, along with any steps you may have performed so far.Upon completing the steps below another staff member will review and take the steps necessary with you to get your machine back in working order clean and free of malware.If you have already posted a DDS log, please do so again, as your situation may have changed.Use the 'Add Reply' and add the new log to this thread.Thanks and again sorry for the delay.We need to see some information about what is happening in your machine. Please perform the following scan:Download DDS by sUBs from one of the following links. Save it to your desktop.DDS.scrDDS.pifDouble click on the DDS icon, allow it to run.A small box will open, with an explaination about the tool. No input is needed, the scan is running.Notepad will open with the results.Foll... Read more

Read other 3 answers

m ades, windows xp sp3
to whomever can help- i tried to remove some viruses
using info from bleeping, but am not having any luck.

i downloaded a file that i thought could help me on another
matter, but it had a virus that zone alarm's active scan did not

it was a rootkit virus. i tried tdsskiller several times as well as
malwarebytes, and thought i finally got rid of it. then another
virus popped up despite my not having connected to the internet.

another was this patch virus that kept redirecting my opera
browser. malwarebytes did not see this, but zone alarm did.
i tried to get rid of it and used tdsskiller, and thought i did.
i had to keep switching between safe mode and
normal mode to do it. i had no problems for two weeks, then
both seemed to pop up again. my guess is that i never
actually got rid of them. i tried zone alarm, malwarebytes,
and tdsskiller over and over again, with no luck. then my
ability to connect to the net went away. i gave up and restored
my hdd using the file i made just after i thought i had gotten
rid of the problems, so that though i would still have the viruses,
i would get back the net. using tdsskiller and malwarebytes
still did not work, and a new virus showed up. .

i'm including the logs from zone alarm, malwarebytes, and tdsskiller.

i would really appreciate help.

first to show up. used tdsskiller, seemed to be removed, kept showing back up.

(Forged): C:\WINDOWS\system32... Read more

A:infected with Rootkit.Win32.ZAccess.e, HiddenFile.Multi.Generic, Trojan.Win32.Patched.mf,, Backdoor.Agent.Gen) -> Value: Sh...

ps i have mbam, zone alarm,tdss,
and hijack logs, but was not sure
how to post them since the number
of text characters on this page
was limited.

Read other 70 answers

Hi! My real-time Anti-virus protection filter (Eset Nod32) has registered som virus activity for the past couple of weeks that i cant seem to get rid of:2010-03-22 11:26:47 Real-time file system protection file I:\System Volume Information\_restore{9307B358-B690-49BE-8C17-30DE253AE1DB}\RP828\A0122539.exe probably a variant of Win32/Agent trojan cleaned by deleting - quarantined NT INSTANS\SYSTEM Event occurred on a file modified by the application: C:\WINDOWS\System32\svchost.exe.2010-03-22 10:34:42 Real-time file system protection file E:\System Volume Information\_restore{9307B358-B690-49BE-8C17-30DE253AE1DB}\RP828\A0123560.exe a variant of Win32/Kryptik.W trojan cleaned by deleting - quarantined NT INSTANS\SYSTEM Event occurred on a file modified by the application: C:\WINDOWS\System32\svchost.exe.2010-03-22 10:34:36 Real-time file system protection file I:\System Volume Information\_restore{9307B358-B690-49BE-8C17-30DE253AE1DB}\RP828\A0122537.exe probably a variant of Win32/Agent trojan cleaned by deleting - quarantined NT INSTANS\SYSTEM Event occurred on a file modified by the application: C:\WINDOWS\System32\svchost.exe.The files (same trojan /s but different executable names after each deletion, for ex: it varies between A0005757.exe, A0005757.inf and svchost.exe and so on) comes keep comming back after deletion of files in qurantine. The DDS l... Read more

A:Infected by Win32/Agent & Win32/kryptik.W Trojan

Hello and welcome to Bleeping ComputerWe apologize for the delay in responding to your request for help. Here at Bleeping Computer we get overwhelmed at times, and we are trying our best to keep up. Please note that your topic was not intentionally overlooked. Our mission is to help everyone in need, but sometimes it takes just a little longer to get to every request for help. No one is ignored here.If you have since resolved the original problem you were having, we would appreciate you letting us know. If not please perform the following steps below so we can have a look at the current condition of your machine. If you have not done so, include a clear description of the problems you're having, along with any steps you may have performed so far.Upon completing the steps below another staff member will review and take the steps necessary with you to get your machine back in working order clean and free of malware.If you have already posted a DDS log, please do so again, as your situation may have changed.Use the 'Add Reply' and add the new log to this thread.Thanks and again sorry for the delay.We need to see some information about what is happening in your machine. Please perform the following scan:Download DDS by sUBs from one of the following links. Save it to your desktop.DDS.scrDDS.pifDouble click on the DDS icon, allow it to run.A small box will open, with an explaination about the tool. No input is needed, the scan is running.Notepad will open with the results.Foll... Read more

Read other 3 answers

My computer has been infected with Win32/Rootkit.Agent.ODG trojan and Win32/Olmarik.JU trojan. AVG, ESET NOD32, and Avira couldn't delete it, and I want to delete it. It redirected all Google searches and slows down my computer. Can you please help me. Thanks ahead to anyone who can help.Here is the HJT logfile:Logfile of Trend Micro HijackThis v2.0.2Scan saved at 2:28:51 PM, on 18/08/2009Platform: Windows XP SP3 (WinNT 5.01.2600)MSIE: Internet Explorer v8.00 (8.00.6001.18702)Boot mode: NormalRunning processes:C:\WINDOWS\System32\smss.exeC:\WINDOWS\system32\winlogon.exeC:\WINDOWS\system32\services.exeC:\WINDOWS\system32\lsass.exeC:\WINDOWS\system32\Ati2evxx.exeC:\WINDOWS\system32\svchost.exeC:\Program Files\Windows Defender\MsMpEng.exeC:\WINDOWS\System32\svchost.exeC:\WINDOWS\system32\svchost.exeC:\WINDOWS\system32\ZoneLabs\vsmon.exeC:\Program Files\CheckPoint\ZAForceField\IswSvc.exeC:\WINDOWS\system32\LEXBCES.EXEC:\WINDOWS\system32\spoolsv.exeC:\WINDOWS\system32\LEXPPS.EXEC:\WINDOWS\Explorer.EXEC:\Program Files\Avira\AntiVir Desktop\sched.exeC:\Program Files\Avira\AntiVir Desktop\avguard.exeC:\Program Files\Common Files\Apple\Mobile Device Support\bin\AppleMobileDeviceService.exeC... Read more

A:Infected with Win32/Rootkit.Agent.ODG trojan and Win32/Olmarik.JU trojan

Hello and to Bleeping ComputerWe apologize for the delay in responding to your request for help. Here at Bleeping Computer we get overwhelmed at times, and we are trying our best to keep up. Please note that your topic was not intentionally overlooked. Our mission is to help everyone in need, but sometimes it takes just a little longer to get to every request for help. No one is ignored here.If you have since resolved the original problem you were having, we would appreciate you letting us know. If not please perform the following steps below so we can have a look at the current condition of your machine. If you have not done so, include a clear description of the problems you're having, along with any steps you may have performed so far.Upon completing the steps below another staff member will review and take the steps necessary with you to get your machine back in working order clean and free of malware.If you have already posted a DDS log, please do so again, as your situation may have changed.Use the 'Add Reply' and add the new log to this thread.Thanks and again sorry for the delay.-----------------------------------------------------------We need to see some information about what is happening in your machine. Please perform the following scan:Download DDS by sUBs from one of the following links. Save it to your desktop.DDS.scrDDS.pifDouble click on the DDS icon, allow it to run.A small box will open, with an explaination about the tool. No input is needed, ... Read more

Read other 20 answers

The last two days my computer has frozen up while trying to surf around online. This seemed weird so I ran a full system scan with symantec endpoint both days. Both times the logs came back with no risks detected. Today I started getting internet explorer pops directing me to sites. I knew at this point I had an infection that endpoint was not picking up. I disabled my network card and used another computer to download some of the suggest programs I've seen on this site. I has hoping to at least get the problem quarantined so that I would feel safe enough to enable the network card again. After running the utilities, I am not freezing when surfing web pages and have resumed using the computer. I would like help making sure that my computer is clean since endpoint obviously isn't catching this problem. Below are the logs for Kaspersky Online Scan & DSS.Deckard's System Scanner v20071014.68Run by bgedeon on 2008-07-29 14:40:22Computer is in Normal Mode.---------------------------------------------------------------------------------- HijackThis (run as bgedeon.exe) ---------------------------------------------Logfile of Trend Micro HijackThis v2.0.2Scan saved at 14:40, on 2008-07-29Platform: Windows XP SP3 (WinNT 5.01.2600)MSIE: Internet Explorer v6.00 SP3 (6.00.2900.5512)Boot mode: NormalRunning processes:C:\WINDOWS\System32\smss.exeC:\WINDOWS\system32\winlogon.exeC:\WINDOWS\system32\services.exeC:\WINDOWS\s... Read more

A:Infected With Trojan.win32.monder.bcb & Trojan-downloader.win32.agent.xxa

I continued to investigate on my own. Combofix quaratined some files, but did not delete them. A scheduled full system scan with endpoint finally picked up some infections with the newest updates loaded. Symantec scan labels the infections as Trojan.Vundo and Trojan.Metajuan. Metajuan was removed automatically, but Vundo proved to be a little more pesky. Symantec offers a removal tool for Vundo on there website. I opted to try out Malwarebytes' Anti-Malware (mbam). It was able to located the files that were in quaratine and some infected files that were in system restore. I disable system restore to avoid any problems and mbam was able to delete all the files. After a system restart, I scanned with Symantec Vundo tool and found no further signs of infection. Mbam did a good job Re-enabled system restore and recreated a fresh restore point. I'm hoping that this will be in the end of this problem, but would still be interested in someone combing through some of my logs to see if anything was missed. I'm still a little miffed that endpoint had not picked these infections up when they are not exactly new threats and I had the most current definitions when I ran my previous scans.

Read other 10 answers

i am sorry to post a log over here, as i have read through the forum and try to resolve the problem on my own but i failed.since i had ran the comboFix, so i feel that it may be of help to post it.sorry for the trouble..here's the log file...ComboFix 09-07-28.06 - Bentley 07/30/2009 0:35.1.8 - NTFSx86Microsoft? Windows Vista? Ultimate 6.0.6001.1.1252.1.1033.18.3069.1872 [GMT 8:00]Running from: c:\users\Bentley\Desktop\ComboFix.exeSP: SUPERAntiSpyware *disabled* (Updated) {222A897C-5018-402e-943F-7E7AC8560DA7}SP: Windows Defender *enabled* (Updated) {D68DDC3A-831F-4FAE-9E44-DA132C1ACF46} * Created a new restore point.((((((((((((((((((((((((((((((((((((((( Other Deletions ))))))))))))))))))))))))))))))))))))))))))))))))).c:\windows\Install.txtc:\windows\system32\tmp0_144047822718.bkc:\windows\system32\tmp0_16962678345.bkc:\windows\system32\tmp0_205418834021.bkc:\windows\system32\tmp0_355351885288.bkc:\windows\system32\tmp0_424346226483.bkc:\windows\system32\tmp0_516880812123.bkc:\windows\system32\tmp0_517948877969.bkc:\windows\system32\tmp0_525286544717.bkc:\windows\system32\tmp0_687442396617.bkc:\windows\system32\tmp0_77071886817.bkc:\windows\system32\tmp0_779592338841.bkc:\windows\system32\tmp0_790261416358.bkc:\windows\system32\tmp2_1075327197... Read more

A:Infected with win32/rootkit.agent.ODG trojan and win32/Olmarik.JU trojan

Hello and welcome to Bleeping ComputerWe apologize for the delay in responding to your request for help. Here at Bleeping Computer we get overwhelmed at times, and we are trying our best to keep up. Please note that your topic was not intentionally overlooked. Our mission is to help everyone in need, but sometimes it takes just a little longer to get to every request for help. No one is ignored here.If you have since resolved the original problem you were having, we would appreciate you letting us know. If not please perform the following steps below so we can have a look at the current condition of your machine. If you have not done so, include a clear description of the problems you're having, along with any steps you may have performed so far.Upon completing the steps below another staff member will review and take the steps necessary with you to get your machine back in working order clean and free of malware.If you have already posted a DDS log, please do so again, as your situation may have changed.Use the 'Add Reply' and add the new log to this thread.Thanks and again sorry for the delay.We need to see some information about what is happening in your machine. Please perform the following scan:Download DDS by sUBs from one of the following links. Save it to your desktop.DDS.scrDDS.pifDouble click on the DDS icon, allow it to run.A small box will open, with an explaination about the tool. No input is needed, the scan is running.Notepad will open with the results.Foll... Read more

Read other 2 answers

I have been wondering what has been wrong with my XP Install for about a month now and I just updated Nod32 to the latest version and as soon as the install was complete it came back at me with these ; Win32/Rootkit.Agent.ODG Trojan, and Win32/Agent.ODG virus. Tells me it is installed in the operating memory and it is unable to clean . Anyone have any Ideas on this pesky @##$$%%!!!! Have tried to install and reinstall my paid for edition of SuperAntispyWare with no luck seems to block the instillation no matter how many times I try to install. Have also tried to install Malwarebytes with no luck either seems to block what I'm trying from the get go. Have attached a HJT Log also if it will help. I didn't see anything unusual but I sure could use some help here. About a month ago I was on line doing some research and GOGGLING and all when I noticed the links in goggle were taking me to places that had nothing to do with the link ? Will stay in touch .

A:Win32/RootKit.Agent.ODG Trojan or Win32/Agent.ODG Virus

Totally !!

Read other 3 answers

Hi there,
Sorry for this repetitive question but I'm new to antivirus forum discussion. I'm trying to get rid of the above mentioned malware/virus. I've tried running webroot, Symantec endpoint, and smitfraudfix in safe mode (webroot and symantec were run one at a time while the other software was disabled).
Webroot and symantec found and quarantined a few threats but I ran KASPERSKY ONLINE SCANNER 7 REPORT which identified these threats still found in my computer.
C:\Program Files\GetPack\GetPack27.exe Infected: not-a-virus:AdWare.Win32.Agent.jok 1
C:\WINDOWS\system32\wpv791232083449.cpx Infected: not-a-virus:AdWare.Win32.Agent.jok 1
C:\WINDOWS\system32\xxyyxwxY.dll Infected: Trojan.Win32.Monder.aort 1

THe Getpack27 folder I deleted but who knows if it will return.

Don't know how to get rid of the other two threats - Trojan.Win32.Monder.aort and not-a-virus:AdWare.Win32.Agent.jok.

Ran Hijack this and the log result is the following:

Logfile of Trend Micro HijackThis v2.0.2
Scan saved at 2:29:32 PM, on 1/18/2009
Platform: Windows XP SP3 (WinNT 5.01.2600)
MSIE: Internet Explorer v7.00 (7.00.6000.16762)
Boot mode: Normal

Running processes:
C:\Program Files\Webroot\WebrootSecurity\WRConsumerService.exe
C:\Program Files\Syma... Read more

A:Trojan.Win32.Monder.aort and not-a-virus:AdWare.Win32.Agent.jok

Hello, ahns75
Welcome to TSF

My name is Billy O'Neal and I will be helping you. (Billy or Bill is fine, if you like.)
Please give me some time to look over your computer's log(s).
Please take note of the following:In the meantime, please refrain from making any changes to your computer.
Also, even if things appear to be running better, there is no guarantee that everything is finished. Please continue to check this forum post in order to ensure we get your system completely clean. We do not want to clean you part-way up, only to have the system re-infect itself. :)
If you do not understand any step(s) provided, please do not hesitate to ask before continuing. I would much rather clarify instructions or explain them differently than have something important broken.
Finally, please reply using the button in the lower left hand corner of your screen.
Old topics are closed after 3 days with no reply, and working topics are closed after 5 days. If for any reason you cannot complete instructions within that time, that's fine, just put a post here so that I know you're still here. We get a lot of people who simply leave, and if there is no contact for that amount of time I will have to assume you have "vanished" .

Please follow the instructions located here:


Then reply back with the generated reports.

In your next reply, please include the following:DDS.txt
Attach.txt (Zipped and attached)
Ark.txt (Zi... Read more

Read other 9 answers

hi , kaspersky scan(included at the end ) came up with a few infections, please help me with removal logs:Logfile of random's system information tool 1.04 (written by random/random)Run by Yanai Michael at 2008-12-14 13:16:05Microsoft Windows XP Home Edition Service Pack 3System drive C: has 4 GB (9%) free of 53 GBTotal RAM: 1526 MB (53% free)Logfile of Trend Micro HijackThis v2.0.2Scan saved at 13:16:16, on 14/12/2008Platform: Windows XP SP3 (WinNT 5.01.2600)MSIE: Internet Explorer v7.00 (7.00.6000.16762)Boot mode: NormalRunning processes:C:\WINDOWS\System32\smss.exeC:\WINDOWS\system32\winlogon.exeC:\WINDOWS\system32\services.exeC:\WINDOWS\system32\lsass.exeC:\WINDOWS\System32\ibmpmsvc.exeC:\WINDOWS\system32\svchost.exeC:\WINDOWS\System32\svchost.exeC:\Program Files\Intel\Wireless\Bin\EvtEng.exeC:\Program Files\Intel\Wireless\Bin\S24EvMon.exeC:\WINDOWS\system32\spoolsv.exeC:\Program Files\Bonjour\mDNSResponder.exeC:\Program Files\CheckPoint\SSL Network Extender\slimsvc.exeC:\Program Files\Google\Common\Google Updater\GoogleUpdaterService.exeC:\Program Files\IBM\IBM Rapid Restore Ultra\rrpcsb.exeC:\Program Files\Common Files\Microsoft Shared\VS7Debug\mdm.exeC:\Program Files\Microsoft LifeCam\... Read more

A:got Trojan.Win32.Agent.asvc Trojan-GameThief.Win32.Magania.amrr Worm.Win32.AutoRun.trh

Welcome to the BleepingComputer Forums. Since it has been a few days since you scanned your computer with HijackThis, we will need a new HijackThis log. If you have not already downloaded Random's System Information Tool (RSIT), please download Random's System Information Tool (RSIT) by random/random which includes a HijackThis log and save it to your desktop. If you have RSIT already on your computer, please run it again. Double click on RSIT.exe to run RSIT. Click Continue at the disclaimer screen. After it has finished, two logs will open. Please post the contents of both. log.txt will be maximized and info.txt will be minimized. Thank you for your patience.Please see Preparation Guide for use before posting about your potential Malware problem. Thank you for your patience.If you have already posted this log at another forum or if you decide to seek help at another forum, please let us know. There is a shortage of helpers and taking the time of two volunteer helpers means that someone else may not be helped. While we are working on your HijackThis log, please: Reply to this thread; do not start another! Do not make any changes on your computer during the cleaning process or download/add programs on your computer unless instructed to do so. Do not run any other tool until instructed to do so! Let me know if any of the links do not work or if any of the tools do not work. Tell me about problems or symptoms that occur during the fix. Do... Read more

Read other 7 answers

Hi,It seems that I have trojan activity on my home pc.I am running Vista and when I log in to my user profile I get a blue desktop with a box saying 'Warning! Spyware detected on your computer! Install an antivirus or spyware remover to clean your computer'I have tried a few malware removal programs, Malwarebytes, CCleaner, Adaware and ran virus scans in an attemp to try and remove it myself without bothering you guys but I just can't shift it, so I'm hoping you may have the time to help?What I have noticed is that I only get these warnings when I am logged into my user profile, not as administrator or as another user on the pc. I also get no warnings when running in safe mode.I run Avast and that brings up a warning soon after the blue desktop comes up that points to infection with C:\Users\Guy\AppsData\Local\Temp\tt991.tmp.vbs. The numbers/letters after the tt (in this case 991) change each time I log in. It also states Malware Name: VBS:Malware-gen, Malware Type: Virus/Worm, VBS verison 080805-0,08/05/08 which I try and delete from the warning box.I then am greeted with a windows script host message box that will say the above file (tt991.tmp.vbs) failed (Access Denied).I also regularly get Windows security alert message boxes come up on the screen saying that Windows Firewall has detected activity of harmfull software with mention of one of many trojans. These have been:Trojan-Clicker.Win32.Tiny.hTrojan-Downloader.Win32.Agent.bqTrojan... Read more

A:Vbs:malware-gen - Trojan-clicker.win32.tiny.h, Trojan-downloader.win32.agent.bq, Trojan-spy.win32.keylogger.aa

Hi,I am hoping you can help me.My computer keeps telling me it is infected with spyware/malware. I get a blue desktop on startup with regular warnings saying the computer is infected with:Trojan-Clicker.Win32.Tiny.hTrojan-Downloader.Win32.Agent.bqTrojan-Spy.Win32.KeyLogger.aaTrojan-Spy.Win32.GreenScreenTrojan-Spy.HTML.Bankfraud.dqStrange thing is that these only show up when I log in to my user account. If I log in as administrator, another user or as any user in safe mode I get no warnings and nothing shows up on scans.The pop up warings direct me to this site: www.antispyware-review.info/?wmid=46638&pwebmid=uWfLn0pimL&a= which is Smartsoft reviews to buy PC Antispy or PC Clean pro.Malwarebytes scan picks up Fake.Dropped.Malware, Malware.Trace, Trojan.FakeAlert and Hijack.Wallpaper and even if I remove these and restart the PC they come back.A spybot scan pointed to 2 entries of VirtumondeI'll attach the latest HJT log, Malwarebytes log and Spybot logs in case you need them. Please help me with this, I cant seem to shift it Logfile of Trend Micro HijackThis v2.0.2Scan saved at 11:54:34 AM, on 8/7/2008Platform: Windows Vista SP1 (WinNT 6.00.1905)MSIE: Internet Explorer v7.00 (7.00.6001.18000)Boot mode: NormalRunning processes:C:\Windows\system32\taskeng.exeC:\Windows\system32\Dwm.exeC:\Windows\Explorer.EXEC:\Program Files\Windows Defender\MSASCui.exeC:\Windows\RtHDVCpl.exeC:\Program Files\Ado... Read more

Read other 5 answers

I have printed off the new instructions - read this before posting for malware removal help. I have starting following the directions. I download and run gmer rootkit scanner. I follow the instructions exactly but every time it gets to a certain point of scanning it closes down completely. I try to run my computer in safe mode of any kind and I can not do so at all. I have Charter Security Suite. I have uninstalled it and run Avast for home the free one, spybot seek and destroy (which took care of 59 things the others didn't). None of them will get rid of the Trojan-Proxy.Win32.Agent.bpi that is at: C:\windows\system32\lsp.dll I also have a virus that redirects my google links.

I have the DDS logs available but nothing else. I don't know what to do or where to go.

Any and all help is greatly appreciated.


DDS (Ver_09-06-26.01) - NTFSx86
Run by Marlenes at 11:14:07.65 on Thu 07/09/2009
Internet Explorer: 7.0.5730.13
Microsoft Windows XP Professional 5.1.2600.3.1252.1.1033.18.2046.1514 [GMT -4:00]

AV: Charter Security Suite 8.02 *On-access scanning enabled* (Updated) {E7512ED5-4245-4B4D-AF3A-382D3F313F15}
FW: Charter Security Suite 8.02 *enabled* {D4747503-0346-49EB-9262-997542F79BF4}

============== Running Processes ===============

C:\WINDOWS\system32\svchost -k DcomLaunch
C:\WINDOWS\System32\svchost.exe -k netsvcs
C:\Program F... Read more

Read other answers

ok man. now lets get ready to kick these unwanted ***** out of my comp.

BEFORE u read on, please pardon my emotional language.... ( including some strong language). im trying my best not to be emotional...

i am providing as much information as possible. so please help me.... thanks in advance!


DAMN! after i downloaded a keygen, i got a damn trojan.... man that sux. shouldnt have done it....

now i really dunno WAT to do with the trojan in my comp now.

1. i cannot open some programs like mIRC ( very safe. no virus etc )

However, i still can do the following
1. surf the web ( to seek help here!!! )
2. use virus scanners and such
3. boot up normally


here is my hijackTHIS! log

Logfile of Trend Micro HijackThis v2.0.0 (BETA)
Scan saved at 9:12:23 AM, on 9/3/2007
Platform: Windows XP (WinNT 5.01.2600)
Boot mode: Normal

Running processes:
C:\Program Files\Common Files\Real\Update_OB\realsched.exe
C:\Program Files\Java\jre1.5.0_05\bin\jusched.exe
C:\Program Files\MSN Messenger\MsnMsgr.Exe
C:\Program Files\Internet Explor... Read more

A:Virus.Win32.Virut + Trojan.Win32.Agent.bck

Another solution i tried

i was recommended by some guy from another forum to try tthe free kaspersky online scanner. so here are the results
WARNING! below is a very very long scan log of a whooping 749 files infected. its so long, that i have to post it in 2 posts. the log was originally has 63374 characters. but only 30000 characters are allowed.

Sunday, September 02, 2007 9:04:59 AM
Operating System: Microsoft Windows XP Home Edition, (Build 2600)
Kaspersky Online Scanner version:
Kaspersky Anti-Virus database last update: 2/09/2007
Kaspersky Anti-Virus database records: 402384
Scan Settings
Scan using the following antivirus database extended
Scan Archives true
Scan Mail Bases true

Scan Target Critical Areas

Scan Statistics
Total number of scanned objects 13660
Number of viruses found 7
Number of infected objects 749
Number of suspicious objects 0
Duration of the scan process 00:16:43

Infected Object Name Virus Name Last Action
C:\WINDOWS\system32\config\system.LOG Object is locked skipped

C:\WINDOWS\system32\config\software.LOG Object is locked skipped

C:\WINDOWS\system32\config\default.LOG Object is locked skipped

C:\WINDOWS\system32\config\SAM.LOG Object is locked skipped

C:\WINDOWS\system32\config\SECURITY.LOG Object is locked skipped

C:\WINDOWS\system32\config\systemprofile\Local Settings\Temp\pft74~tmp\Reader\AcroRd32.exe Infected: Virus.Win32.Virut.n skipped

C:\WINDOWS\system32... Read more

Read other 3 answers

I have tried to format my PC also. I am posting combofix logs. Please help.

ComboFix 12-08-29.03 - Lovey 30/08/2012 8:03.1.2 - x86
Microsoft Windows XP Professional 5.1.2600.2.1252.1.1033.18.1014.484 [GMT 5.5:30]
Running from: c:\documents and settings\Lovey\Desktop\ComboFix.exe
AV: ESET NOD32 Antivirus 4.2 *Disabled/Updated* {E5E70D32-0101-4F12-8FB0-D96ACA4F34C0}
((((((((((((((((((((((((((((((((((((((( Other Deletions )))))))))))))))))))))))))))))))))))))))))))))))))
((((((((((((((((((((((((((((((((((((((( Drivers/Services )))))))))))))))))))))))))))))))))))))))))))))))))
((((((((((((((((((((((((( Files Created from 2012-07-28 to 2012-08-30 )))))))))))))))))))))))))))))))
(((((((((((((((((((((((((((((((((((((((( Find3M Report ))))))))))))))))))))))))))))))))))))))))))))))))))))
((((((((((((((((((((((((((((((((((((( Reg Loading Points ))))))))))))))))))))))))))))))))))))))))))))))))))
*Note* empty entries & legit default entries are not shown
"IgfxTray"="c:\windows\system32�... Read more

A:Win32/Sality Virus Infected

Greetings evillymind and to BleepingComputer's Virus/Trojan/Spyware/Malware Removal forum.My name is Oh My! and I am here to help you! Now that we are "friends" please call me Gary. If you prefer I call you something other than your screen name I would be pleased to do so.Could you please tell me why you have identified this as a Sality virus and also how you tried to "format" your hard drive. In addition, please consider and perform the below.===================================================Ground Rules:First, I would like to inform you that most of us here at Bleeping Computer offer our expert assistance out of the goodness of our hearts. Please try to match our commitment to you with your patience toward us. If this was easy we would never have met. Please do not run any tools or take any steps other than those I will provide for you while we work on your computer together. I need to be certain about the state of your computer in order to provide appropriate and effective steps for you to take. Most often "well intentioned" (and usually panic driven!) independent efforts can make things much worse for both of us. If at any point you would prefer to take your own steps please let me know, I will not be offended. I would be happy to focus on the many others who are waiting in line for assistance. Please perform all steps in the order they are listed in each set of instructions. Some steps are a bit complicated. ... Read more

Read other 3 answers

got my computer reformatted and installed an anti virus with updated virus database, which found a bunch of infected files with the sality.o virus.
anyways, i ran a check of GMER, and it found some stuff marked in red in the log, dunno what it means so if someone is willing to help i'd really appriciate it.

here is the log.txt

Logfile of random's system information tool 1.04 (written by random/random)
Run by Natan Kalson at 2008-11-01 15:59:50
Microsoft Windows XP Professional Service Pack 2
System drive C: has 151 GB (79%) free of 191 GB
Total RAM: 511 MB (42% free)

Logfile of Trend Micro HijackThis v2.0.2
Scan saved at 3:59:58 PM, on 11/1/2008
Platform: Windows XP SP2 (WinNT 5.01.2600)
MSIE: Internet Explorer v7.00 (7.00.6000.16735)
Boot mode: Normal

Running processes:
C:\Program Files\Lavasoft\Ad-Aware\aawservice.exe
C:\Program Files\Analog Devices\SoundMAX\SMTray.exe
C:\Program Files\CyberLink\PowerDVD\PDVDServ.exe
C:\Program Files\ATI Technologies\ATI.ACE\cli.exe
C:\Program Files\Kaspersky Lab\Kaspersky Anti-Virus 2009\avp.exe
C:\Program Files\MSN Messenger\MsnMsgr.Exe
C:\Pro... Read more

Read other answers

Hello members,

My problem started wen i found folders named Photo.exe and games.exe in my pen drive.

my computer got infected by virus.win32.sality.y. Iitially it blocked the Kaspersky antivirus and it blocked my safe mode also. After rebooting and running a scan with kaspersky, kaspersky deleted a lot of .exe files from my laptop telling them to be infected by same virus. so i lost many of the installed softwares like winrar, winzip, some gmes like DX Ball etc. now system seems to work fine n even safe mode is also working. Scanning wit kaspersky shows no new virus.
However. wen system is kept switched on for few hours kaspersky identifies a virus n on clicking delte it shows this:
deleted: virus Virus.Win32.Sality.y File: C:\System Volume Information\_restore{DC50B92E-714E-4FDB-B42D-DCF2F663EBC0}\RP345\A0131811.exe
After this deletion few mins later kwspersky says it needs to close as it encountered a problem and kaspersky gets disabled. It starts working wen restarted. This cycle keeeps happening again wen the system is left on for few hours.

I ran malwarebytes but it says the system is clean. I downloaded Spybot and it also says the system is clean. However still after using the system for more than 3-4 hours kaspersky shows the same virus, deletes it on request n then kaspersky gets stuck after some time. I am posting my DDS Log.
Also find attached kaspersky log and attach.txt
DDS (Ver_09-05-14.01) - NTFSx86
Run by LUCKY at 12:12:31.67 on ... Read more

A:Infected with Virus.Win32.Sality.y

Hello and to Bleeping ComputerWe apologize for the delay in responding to your request for help. Here at Bleeping Computer we get overwhelmed at times, and we are trying our best to keep up. Please note that your topic was not intentionally overlooked. Our mission is to help everyone in need, but sometimes it takes just a little longer to get to every request for help. No one is ignored here.If you have since resolved the original problem you were having, we would appreciate you letting us know. If not please perform the following steps below so we can have a look at the current condition of your machine. If you have not done so, include a clear description of the problems you're having, along with any steps you may have performed so far.Upon completing the steps below another staff member will review and take the steps necessary with you to get your machine back in working order clean and free of malware.If you have already posted a DDS log, please do so again, as your situation may have changed.Use the 'Add Reply' and add the new log to this thread.Thanks and again sorry for the delay.-----------------------------------------------------------We need to see some information about what is happening in your machine. Please perform the following scan:Download DDS by sUBs from one of the following links. Save it to your desktop.DDS.scrDDS.pifDouble click on the DDS icon, allow it to run.A small box will open, with an explaination about the tool. No input is needed, ... Read more

Read other 3 answers

I have a really bad infection called Sality.NAO on my computer. It spreads every exe file on my computer and even my last updated nod32 antivirus can't able to remove it completely.I did reformat my computer but it did not work , same virus again with its same infections!!! Please Help me! Here is the Log.DDS (Ver_09-02-01.01) - NTFSx86 Run by hede at 15:18:47,75 on 22.02.2009Internet Explorer: 7.0.5730.13Microsoft Windows XP Professional 5.1.2600.3.1254.90.1033.18.1022.399 [GMT 2:00]AV: ESET NOD32 Antivirus 3.0 *On-access scanning enabled* (Updated)============== Running Processes ===============C:\WINDOWS\system32\Ati2evxx.exeC:\WINDOWS\system32\svchost -k DcomLaunchsvchost.exeC:\WINDOWS\System32\svchost.exe -k netsvcsC:\Program Files\Intel\Wireless\Bin\EvtEng.exeC:\Program Files\Intel\Wireless\Bin\S24EvMon.exeC:\Program Files\Intel\Wireless\Bin\WLKeeper.exesvchost.exesvchost.exeC:\WINDOWS\system32\Ati2evxx.exeC:\WINDOWS\Explorer.EXEC:\WINDOWS\System32\WLTRYSVC.EXEC:\WINDOWS\System32\bcmwltry.exeC:\WINDOWS\system32\spoolsv.exeC:\Program Files\LClock\LClock.exeC:\Program Files\Unlocker\UnlockerAssistant.exeC:\Program Files\Java\jre1.6.0_06\bin\jusched.exeC:\WINDOWS\system32\WLTRAY.exeC:\Program Fi... Read more

A:Infected with Win32/Sality.NAO Virus

now I can't even open windows live messenger and the most of the programms , any help would be soo nice for my situation!!!

Read other 10 answers

I hope you can help because I'm flying blind here. I've never come across this type of stubborn virus/malware/trojan.First Symptoms: About one month ago I suddenly lost control of mouse, programs opened up randomly and super fast, complete hijack. Shut down my protection. Shutdown Windows Update. HitMan Pro unresponsive after 2 of scan%.  Repeat Symptoms (I tried cleaning again and again but it keeps coming back) the speed of my SSD (C drive) has been reduced, Start up programs slow. I'm running Malwarebytes, CCleaner and Avast premium at startup/monitoring active.Avast scan result in boot up mode: Win32:Sality-FUM [Drp] Win32:StubOfSality [Trj]Malwarebytes in safe mode with networking: Trojan.MalPack.Gen (File D:\brke.pif), Trojan.MalPack.Gen (File E:\ jejguo.pif)
I have attached print screens of bothSality Killer from Kaspersky: Nothing
^ This machine is relativley new Dell Inspiron 5000: I have swaped my boot up C drive for an ssd that I added with Windows 8.1. The D drive is the original HDD preloaded with Win 8. Thank you!!
Scan result of Farbar Recovery Scan Tool (FRST) (x64) Version:05-03-2016 01
Ran by Windows 8.1 (administrator) on WINDOWS8 (22-03-2016 17:18:20)
Running from C:\Users\Windows 8.1\Downloads
Loaded Profiles: Windows 8.1 (Available Profi... Read more

A:Mlwr Infctn Win32:Sality-FUM [Drp] Win32:StubOfSality [Trj] / Trojan.MalPack.Gen

Hi David-68T,
This scan should tell me whether you have a sality infection, which I am most concerned about. 
This scan can take a long time, so it is best done overnight or when you do not need the computer
 I'd like us to scan your machine with ESET OnlineScan
Hold down Control and click on this link to open ESET OnlineScan in a new window.
Click the button.
For alternate browsers only: (Microsoft Internet Explorer users can skip these steps)
Click on esetsmartinstaller_enu.exe to download the ESET Smart Installer. Save it to your desktop.
Double click on the icon on your desktop.

Check "YES, I accept the Terms of Use."
Click the Start button.
Accept any security warnings from your browser.
Under scan settings, check "Scan Archives" and "Remove found threats"
Click Advanced settings and select the following:
Scan potentially unwanted applications
Scan for potentially unsafe applications
Enable Anti-Stealth technology

ESET will then download updates for itself, install itself, and begin scanning your computer. Please be patient as this can take some time.
When the scan completes, click List Threats
Click Export, and save the file to your desktop using a unique name, such as ESETScan. Include the contents of this report in your next reply.
Click the Back button.
Click the Finish button.

Read other 14 answers

Hello,My computer became infected last night, and It's pretty bad. I became infected with Infected: Trojan:Win32/Alureon.BT, Win32:Jifas-CY, and the others listed (maybe more). Long story short, I'd just watched Harry Potter on dvd, and logged onto the computer to see who he married in the end. I ended up at a Harry Potter encyclipdiea website, and looked it up. Avast went nuts after a few minutes, and showed 4 different virus alerts, and Windows Defender showed 1 as well after I shut down.The virus listed by Defender was Trojan:Win32/Alureon.BT. Avast listed Win32:Jifas-CY, I didn't get the others in time.The last 2 I listed in the title, a "security center alert" claimed it detected these programs trying to acess the internet. It listed one more, but I didn't get it's name in time.I know Alureon is a downloader and backdoor for other viruses, and it basically shuts down security systems, which it's trying to do since windows now thinks I have no anti-virus installed.All of these trojans are listed as "server" and "high risk." I'm not sure a root kit didn't try to make it's way in too.EDIT: I wanted to add a few things in. First, I have XP SP3 set up with multiple accouts, one admin "owner" account and then 1 limited access "user" account. The Viruses came in while the user account was logged on (I am not dumb enough to connect to the internet with an admin account). It seems the Viruses we... Read more

A:Infected: Trojan:Win32/Alureon.BT, Win32:Jifas-CY, Backdoor.Win32.Kbot.al, Net-Worm.Win32.Mytob.t

Hello again.I booted into Safe Mode and ran an Avast scan (which took forever) and it was a waste of time. The stupid thing found nothing wrong, and said the system was clean (which is the opposite it says when you log into the limited user account). The computer (and specially that account at least) is definitely infected. Could the viruses be hiding themselves when in safe mode?Should I scan from a Pre-install environment like BartPE? Or from the Regular "Owner" Admin account? I waited 2 days for the stupid program to scan 700gb (painfully slow for a qaud core, though to be excepted in safe mode), and it was useless.Other than running windows defender (which I'm doing now), and maybe trying MBAM, I'm not sure what to do. I'm not expect enough to dive into programs like OTViewIT and Combofix, so I'll need help here. Please, ANY HELP is appreciated. I would rather NOT wipe the drive and reinstall the whole system, but I need to get this figured out.Does no one have any ideas???

Read other 5 answers

Hi,I'm running Windows XP - Internet Explorer v. 6.00, SP3. Yesterday Avast alerted me to a virus on my computer (I neglected to write down the exact message). At the time, only Gmail was open and an email was being written. I've had some issues with Avast occasionally reporting a false positive, and since nothing was being downloaded at that time, I took no action with Avast. Instead, I immediately did a Quick Scan with MalwareBytes to see if it would find anything. MalwareBytes found and deleted the following: C:\Documents and Settings\HP_Owner\application data\Sun\Java\deployment\cache\\6.0\44\61b86cac-3c0c0928Trojan.FakeAlert.VGenC:\Documents and Settings\HP_Owner\local settings\temp\0.506697477033.exeTrojan.FakeAlert.VGenA second MalwareBytes scan was clean.I looked "Trojan.FakeAlert.VGen" up on Google and then it clicked: for the past few days, Adobe Flash Player has been crashing an awful lot. When it crashes (on Youtube, for example), it tells me the program is out of date and needs to be updated. The weird thing was that sometimes it worked for a while before it crashed, but I dismissed that as being some strange computer quirk. I went to the Adobe web site and tried to install the newest version of Flash Player, but was unable to. I feel foolish, but it never even occurred to me that a virus could be to blame. It concerns me that (assuming the Adobe Flash Pla... Read more

A:Trojan.FakeAlert.VGen, SpyInstall_HPPre.exe, Win32: Mirc-z [PUP], Win32: Kill App-W [PUP] & Win32: Agent-AMXO (Trj)

Download Security Check from HERE, and save it to your Desktop. * Double-click SecurityCheck.exe * Follow the onscreen instructions inside of the black box. * A Notepad document should open automatically called checkup.txt; please post the contents of that document.=============================================================================Please download MiniToolBox and run it.Checkmark following boxes:Report IE Proxy SettingsReport FF Proxy SettingsList content of HostsList IP configurationList last 10 Event Viewer logList Users, Partitions and Memory sizeClick Go and post the result.=============================================================================Download Malwarebytes' Anti-Malware (aka MBAM): http://www.malwarebytes.org/products/malwarebytes_free to your desktop. * Double-click mbam-setup.exe and follow the prompts to install the program. * At the end, be sure a checkmark is placed next to Update Malwarebytes' Anti-Malware and Launch Malwarebytes' Anti-Malware, then click Finish. * If an update is found, it will download and install the latest version. * Once the program has loaded, select Perform quick scan, then click Scan. * When the scan is complete, click OK, then Show Results to view the results. * Be sure that everything is checked, and click Remove Selected. * When completed, a log will open in Notepad. * Post the log back here.Be sure to restart the computer.The log can also be found here:C:\Document... Read more

Read other 13 answers

Just yesterday I appear to have found contracted a virus. No matter what method I use to remove it, everytime I restart my computer, it is back. Hopefully someone will be able to help me. Per Ad-Ware, this is what was found:
Trojan.Win32.Generic!BT - c:\windows\system32\d-link_st3402.dll
Win32.Trojan.Agent - c:\windows\system32\d-link_st3402.dll

I ran the MiniToolBox and have attached the results of that. I tried running going into safe mode and running RKill, then SAS, then rebooting into normal mode and running MBAN but it always seems to come back. I also attached the MBAN log as well.

I hope someone can help, otherwise it looks like a long night of reformatting is ahead of me......

A:Infected with Trojan.Win32.Generic!BT & Win32.Trojan.Agent

Since we're dealing here with ZeroAccess rootkit....Please follow the instructions in ==>This Guide<== starting at Step 6. If you cannot complete a step, skip it and continue.Once the proper logs are created, then make a NEW TOPIC and post it ==>HERE<== Please include a description of your computer issues, what you have done to resolve them, and a link to this topic.If you can produce at least some of the logs, then please create the new topic and explain what happens when you try to create the log(s) that you couldn't get. If you cannot produce any of the logs, then still post the topic and explain that you followed the Prep. Guide, were unable to create the logs, and describe what happens when you try to create the logs.It would be helpful if you post a note here once you have completed the steps in the guide and have started your topic in malware removal. Good luck and be patient.If HelpBot replies to your topic, PLEASE follow Step One so it will report your topic to the team members.

Read other 1 answers


I am on a laptop running Windows 7 and a couple of days ago, Ad-aware found two viruses: Trojan.Win32.Generic!BT & Win32.Trojan.Agent - see details on quarantined items pasted at the bottom of this note. I've tried numerous times to remove the viruses by rebooting, as recommended, and rescanning, but it's only gotten worse. I can now no longer access most of my programs, including any virus scan programs (Adaware, Malwarebytes). I was able to download RKill but when I try to run any of the different versions nothing happens - have tried renaming with no sucess. When using Internet Explorer, Google search is redirected to other sites. I've tried using safe mode with the same results.

Please let me know if you can help? Here's the virus scan log from a few days ago, when I was actually able to run Adaware.

Thanks in advance!!

Scan Log:

Quarantined items:
Description: c:\programdata\f4d55f3b0001577a000a86a2b4eb2367\f4d55f3b0001577a000a86a2b4eb2367.exe Family Name: Trojan.Win32.Generic!BT Engine: 3 Clean status: Success Item ID: 1 Family ID: 0 MD5: 7f544794965c873108012225055eafd6
Description: c:\windows\assembly\gac_32\desktop.ini Family Name: Trojan.Win32.Generic!BT Engine: 3 Clean status: Reboot required Item ID: 1 Family ID: 0 MD5: 878F9B6DA85CB98FCBDF6ABD1730A32F
Description: c:\windows\assembly\temp\u\[email protected] Family Name: Trojan.Win32.Generic!BT Engine... Read more

A:Infected with Trojan.Win32.Generic!BT & Win32.Trojan.Agent

Hello, let see if we can do these.If RKill still fails ,move on.Please click Start > Run, type inetcpl.cpl in the runbox and press enter.Click the Connections tab and click the LAN settings option.Verify if "Use a proxy..." is checked, if so, UNcheck it and click OK/OK to exit.Please download MiniToolBox, save it to your desktop and run it. Checkmark the following checkboxes: Flush DNS Report IE Proxy Settings Reset IE Proxy Settings Report FF Proxy Settings Reset FF Proxy Settings List content of Hosts List IP configuration List Winsock Entries List last 10 Event Viewer log List Installed Programs List Devices List Users, Partitions and Memory size. List Minidump FilesClick Go and post the result (Result.txt). A copy of Result.txt will be saved in the same directory the tool is run. Note: When using "Reset FF Proxy Settings" option Firefox should be closed.Reboot into Safe Mode with Networking How to enter safe mode(XP/Vista)Using the F8 MethodRestart your computer. When the machine first starts again it will generally list some equipment that is installed in your machine, amount of memory, hard drives installed etc. At this point you should gently tap the F8 key repeatedly until you are presented with a Windows XP Advanced Options menu. Select the option for Safe Mode with Networking using the arrow keys. Then press enter on your keyboard to boot into Safe Mode. >>>> Download this file and doubleclick on it to run it. Allow the informat... Read more

Read other 15 answers

I have a nasty infection that has taken over my machine and which I cannot remove. The infection seems to hijack the google page and any links that I click from this page take me to what appears to be rogue websites, which want me to download their stuff.

I am currently running ESET Nod 32 and Ad-aware Anniversary Edition. Both these programs are picking up the trojan infections but are unable to clean.

I have tried to install malwarebytes but have been unable to do so. I did try changing the exe name of malwarebytes (as advised on this site) but the program does not fully complete the installation.

I have downloded the DDS tool, ran the scan and have now attached the lod to this post.

Also here is a copy of the Ad-aware scan log (I did not complete the scan due to the computer constantly crashing):

Logfile created: 10/06/2009 18:19:4
Lavasoft Ad-Aware version: 8.0.5
Extended engine version: 8.1
User performing scan: SYSTEM

*********************** Definitions database information ***********************
Lavasoft definition file: 148.49
Extended engine definition file: 8.1

******************************** Scan results: *********************************
Scan profile name: Smart Scan (ID: smart)
Objects scanned: 70104
Objects detected: 7
Type Detected
Processes.......: 1
Registry entries: 0
Hostfile entries: 0
Files...........: 6
Folders.........: 0
LSPs............: 0
Cookies............ Read more

A:Infected with WIN32 Trojan Agent and WIN32 trojan TDSS

Hello. I am PropagandaPanda (Panda or PP for short), and I will be helping you.Disable Realtime ProtectionAntimalware programs can interfere with ComboFix and other tools we need to run. Please temporarily disable all realtime protections you have enabled. Refer to this page, if you are unsure how.Download and Run ComboFixDownload Combofix by sUBs from any of the links below, and save it to your desktop.Link 1, Link 2, Link 3 Close/disable all anti-virus and anti-malware programs so they do not interfere with the running of ComboFix. Refer to this page if you are not sure how.Double click on ComboFix.exe and follow the prompts. If you are using Windows Vista, right click the icon and select "Run as Administrator". You will not recieve the prompts below if you are not using Windows XP. ComboFix will check to see if you have the Windows Recovery Console installed.If you did not have it installed, you will see the prompt below. Choose YES.
When the Recovery Console has been installed, you will see the prompt below. Choose YES.
When finished, ComboFix will produce a report for you. Please post the contents of the log (C:\ComboFix.txt).Leave your computer alone while ComboFix is running. ComboFix will restart your computer if malware is found; allow it to do so.Download and Run Scan with GMERWe will use GMER to scan for rootkits.Please download GMER to your desktop. Note that the file will be randomly named to prevent active malware from stopping the download.Close all other ope... Read more

Read other 7 answers

About a week ago, I noticed my laptop computer began running much more slowly than it had been in the past. I then tried to open up Windows Task Manager, and got the message, "Task Manager has been disabled by your administrator." Somewhat alarmed, I then attempted to run "regedit" to allow me to re-enable the task manager. It gave me the following error, "Registry editing has been disabled by your administrator." I then realized that Windows Firewall was turned off, and locked, with a message on the top, saying, "For your security, some settings are controlled by Group Policy". I tried to open McAfee antivirus, and found that it would not open. I then attempted to download and install Ad Aware Antivirus, which installed, but would not open, and popped up the following message, "System error: 1810 has occurred. Description: Service is not online. Application terminates." I then downloaded SpyBot-Search and Destroy, and installed it, but it would not run. The virus killed the application before it could initiate. None of the online scans would load for me, so finally, I downloaded and installed McAfee AVERT Stinger, which opened and proceeded to scan. It began to detect the Win32/Sality virus, but could not repair any of the files. The infected files were all .exe files, and were all located in Program Files. After this one scan, McAfee AVERT Stinger would not run again, and displayed the following message, "Stinger may be... Read more

A:Computer infected with Win32/Sality virus

Hello gforce422 Welcome to the BC HijackThis Log and Analysis forum. I will be assisting you in cleaning up your system.I ask that you refrain from running tools other than those we suggest to you while we are cleaning up your computer. The reason for this is so we know what is going on with the machine at any time. Some programs can interfere with others and hamper the recovery process.In the upper right hand corner of the topic you will see a button called Options. If you click on this in the drop-down menu you can choose Track this topic. By doing this and then choosing Immediate E-Mail notification and then clicking on Proceed you will be advised when we respond the your topic and facilitate the cleaning of your machine.After 5 days if a topic is not replied to we assume it has been abandoned and it is closed.Let's see if you can run the two programs below:Please do an online scan with Kaspersky WebScannerClick on Kaspersky Online ScannerYou will be prompted to install an ActiveX component from Kaspersky, Click Yes.The program will launch and then begin downloading the latest definition files:Once the files have been downloaded click on NEXT
Now click on Scan SettingsIn the scan settings make that the following are selected:Scan using the following Anti-Virus database:Extended (if available otherwise Standard)
Scan Options:Scan Archives
Scan Mail BasesClick OKNow under select a target to scan:Select My ComputerThis will program will start and scan your system.The sc... Read more

Read other 34 answers

I just downloaded Combofix (January 29th 2013 at 13.30 o'clock West-European time) and Microsoft Security Essentials detected the WIN32/Sality.AT virus inside the downloaded file; see the follwing picture for the MSE warning:https://skydrive.live.com/redir?resid=681F5E0CC962B14A!608&authkey=!f5EYQ7ms3k8%24I have been using Combofix for many, many years and never experienced this before: HOW is this possible ???? This should NEVER happen !!!!

A:Combofix infected by WIN32/Sality.AT virus

Yes I can confirm that indeed the ComboFix Installer does contain the sality virus within its iexplore.exe file. This needs to be replaced with a clean version of iexplore.exe as soon as possible.

Read other 3 answers

Hi,My parent's computer has just recently started to act up. My generic search lead to me noticing a cmd.exe process running twice to use 95-100% of the CPU as well as 2 iexplore.exe processes running at startup which would turn into 10 processes within five minutes of startup. I ran antivirus, antimalware, etc.. scans to see if the problem would go away. I don't see the cmd.exe & iexplore.exe process problems recurring, but there are muliple trojan horse & virus warnings coming from AVG Anti-Virus & Kaspersky as you'll see.---------------------main log---------------------Deckard's System Scanner v20071014.68Run by Owner on 2008-05-13 15:27:10Computer is in Normal Mode.--------------------------------------------------------------------------------Total Physical Memory: 504 MiB (512 MiB recommended).-- HijackThis (run as Owner.exe) -----------------------------------------------Logfile of Trend Micro HijackThis v2.0.2Scan saved at 3:27:14 PM, on 5/13/2008Platform: Windows XP SP2 (WinNT 5.01.2600)MSIE: Internet Explorer v6.00 SP2 (6.00.2900.2180)Boot mode: NormalRunning processes:C:\WINDOWS\System32\smss.exeC:\WINDOWS\system32\winlogon.exeC:\WINDOWS\system32\services.exeC:\WINDOWS\system32\lsass.exeC:\WINDOWS\system32\svchost.exeC:\WINDOWS\System32\svchost.exeC:\WINDOWS\system32\svchost.exeC:\WINDOWS\system32\spoolsv.exeC:\Program Files\... Read more

A:Infected With Trojan Horses: Sheur.bfol, Psw.generic6.hte, Psw.agent.swb And Virus Win32/polyctrypt

Welcome to Bleeping Computer, please be sure you have read and followed the Preparation Guide For Use Before Posting A Hijackthis Log, Instructions for receiving help in cleaning your computer http://www.bleepingcomputer.com/forums/t/34773/preparation-guide-for-use-before-using-malware-removal-tools-and-requesting-help/All advice given is taken at your own risk.Tony, I apologize for the wait, if your issues are not resolved, read the instructions posted above and then follow the directions below. If you no longer need help, I would appreciate a quick post letting me know so I can close your topic.Post a new HijackThis log and describe any symptoms. Post any error messages you received word for word.Thanks

Read other 6 answers

A couple of days ago, I've made a stupid mistake. I've downloaded and installed a software from the internet without checking everything first. This software apparently installed in the same time, and without my consent, Iminent start search bar.
When the installation ended, my browser (chrome) crashed immediately. I've tried to open it again, new crash. 
Freaked out, I've used the system save to come back to a previous version of the computer. My last copy was from the day before. 
I thought it would be enough. But after a doubt yesterday evening, I've run a quick scan with malwarebytes. It found 530 malware in the system.
I've then looked in panic all over the web to find a solution and found this thread : http://www.bleepingcomputer.com/forums/t/486024/cannot-get-rid-of-iminent/
I've done :
TDSS killer - nothing found
Farbar's MiniToolBox - useless
AdwCleaner by Xplode - Search for Adware - 2 things on browser found and deleted
Junkware Removal Tooll by thisisu - found secret sauce file
Then, I thought it was all good. But tonight I run a new scan with the other software of the thread.
ESET online scanner
For the time being, it found 11 files infected with win32/sality.nba , win32/browseFox.B application, and sality worm for other drivers.
I'm totally freaked out, the scan doesn't seem to work anymore and is blocked on 43% for 10 minutes now. What do I do ? Do I restore the whole system tomorrow ? (I don't hav... Read more

A:Infected by win32/Sality.nba and win32/browseFox.B

Sality is polymorphic file infector. Virus:Win32/Sality.AT is a detection for a virus that spreads by infecting Windows executable files and by copying itself to removable and remote drives. It also terminates various security products, prevents certain Windows utilities from executing and attempts to download additional files from a predefined remote Web server.
All passwords should be changed immediately to include those used for banking, email, eBay, paypal and online forums. You should consider them to be compromised. You should change each password using a clean computer and not the infected one. If not, an attacker may get the new passwords and transaction information. If using a router, you need to reset it with a strong logon/password so the malware cannot gain control before connect again.
Sality is not effectively disinfectable. Your best option is to perform a full reformat as there is no guarantee this infection can be completely removed. In most instances it may have caused so much damage to your system files that it cannot be completely cleaned or repaired. In many cases the infected files cannot be deleted, and anti-malware scanners cannot disinfect them properly. Many experts in the security community believe that once infected with this type of malware, the best course of action is to wipe the drive clean, reformat and reinstall the OS.
See here for more information about S... Read more

Read other 17 answers

My computer was infected with the Win 32 Sality Virus and I managed to get most of it healed using AVG Win 32 Sality Virus remover. I was running a scan using Avast Home Edition to see what was left, and it says that my Windows system 32 is corrupted with the virus. I know that this folder has all the files necessary to use the operating system, so I don't want to do anything to harm it, as I really can't afford to fix this computer or lose my work. I would really apprecite some advice on how to treat this problem. I am really scared out of my mind.

A:c:\windows\system32\logon.scr infected with Win32 Sality Virus

Hello and welcome to TSF

We want all our members to perform the steps outlined in the link I'll give you below, before posting for assistance. There's a sticky at the top of this forum, and a

Having problems with spyware and pop-ups? First Steps

link at the top of each page.


Please follow our pre-posting process outlined here:


After running through all the steps, you shall have a proper set of logs. Please post them in a new topic, as this one shall be closed.

If you have trouble with one of the steps, simply move on to the next one, and make note of it in your reply.

Please start a new thread in our Virus/Trojan/Spyware forum along with the required logs

Please note that the Virus/Trojan/Spyware Help forum is extremely busy, and it may take a while to receive a reply.

Read other 1 answers

Hey folks.

I am currently using a Presario 900 (p910ap, to exact) machine with a 1.5ghz athlon processor and 256mb of ram. Basically, i plugged in my portable hard drive in all the wrong places, and ended up getting most of its executable files infected with win32.sality and a few trojans as well.

I was unaware of the presence of these, as the computer did not have an antivirus at that time. Anyway, long story short, i used the Plop bootmanager to reinstall windows from a thumb drive, as the computer bios is too old to boot from usb and the cd drive isn't working.

Now that i have a new copy of windows xp home edition installed along with Avast Free antivirus, i am unsure whether i should plugin my portable HDD or not.

Will it infect the computer immediately if autoplay is turned on? Will the virus be removed by avast easily?

I am prepared to lose all the infected executables (they are mostly setups) if that means that the computer is safe. But the rest of the data inside the HDD is very valuable.

Any help will be greatly appreciated.

Read other answers

Hi, as I've seen a post earlier about this problem, I wanted to post to inquire about the same problem I have, which the "trojan-Downloader.Win32.Agent Variant" warning shows up when I try to open World of Warcraft, I've used Norton Anti Virus to scan but for some reason I found nothing.

As in the previous post it mentioned downloading hijickthis and posting the findings..I was wondering if anyone could assist me with this and the steps... much appreciated.


A:Trojan-Downloader.Win32.Agent Variantder-win32-agent-variant.html

Here is the hijackthis log as follows, please assit on the next steps. thanks
Logfile of HijackThis v1.99.1
Scan saved at 1:44:31 AM, on 5/16/2007
Platform: Windows XP SP2 (WinNT 5.01.2600)
MSIE: Internet Explorer v6.00 SP2 (6.00.2900.2180)

Running processes:
C:\Program Files\Common Files\Virtual Token\vtserver.exe
C:\Program Files\Intel\Wireless\Bin\EvtEng.exe
C:\Program Files\Intel\Wireless\Bin\S24EvMon.exe
C:\Program Files\Common Files\Symantec Shared\ccEvtMgr.exe
c:\program files\common files\logishrd\lvmvfm\LVPrcSrv.exe
C:\Program Files\ThinkPad\Bluetooth Software\bin\btwdins.exe
C:\Program Files\IBM\IBM Rapid Restore Ultra\rrpcsb.exe
C:\Program Files\Norton AntiVirus\navapsvc.exe
C:\Program Files\Intel\Wireless\Bin\RegSrvc.exe
C:\Program Files\Analog Devices\SoundMAX\SMAgent.exe
C:\Program... Read more

Read other 3 answers

old sony laptop with windows xp pro sp3 intel pentium 3 with 640 MB rami've got some nasty bugs on my laptop. i can remove them with spybot or malwarebytes, but they come back every time i restart the pc. they are able to turn off windows firewall and symantec anti-virus autoprotect. my laptop got infected after my desktop, so both are only in safemode and off the network for now. any help would be greatly appreciated.from spybot:win32.delf.ucfrom malwarebytes:HKEY_LOCAL_MACHINE\SOFTWARE\Microsoft\Windows NT\CurrentVersion\Windows\llpinit_dlls (Spyware.Agent.H) -> Quarantined and deleted successfully.C:\WINDOWS\system32\nvtpm32.dll (Spyware.Agent.H) -> Delete on reboot.C:\WINDOWS\system32\D.tmp (Trojan.Agent) -> Quarantined and deleted successfully.C:\WINDOWS\system32\E.tmp (Trojan.Agent) -> Quarantined and deleted successfully.C:\WINDOWS\system32\F.tmp (Trojan.Agent) -> Quarantined and deleted successfully.C:\WINDOWS\system32\azton.mt (Trojan.Agent) -> Quarantined and deleted successfully.Here is my log from HijackThis:Logfile of Trend Micro HijackThis v2.0.2Scan saved at 7:41:32 AM, on 3/2/2009Platform: Windows XP SP3 (WinNT 5.01.2600)MSIE: Internet Explorer v7.00 (7.00.6000.16791)Boot mode: NormalRunning processes:C:\WINDOWS\System32\smss.exeC:\WINDOWS\system32\winlogon.exeC:\WINDOWS\system32\services.ex... Read more

A:Laptop infected with win32.delf.uc, Spyware.Agent.H, and Trojan.Agent

you can close this out as i actually just did a clean reinstall of the OS. however, if anyone can help me with my other PC i'd prefer to not reinstall it as well:http://www.bleepingcomputer.com/forums/t/207842/desktop-infected-with-trojanagent-more/it has:trojan.agentadware.cometadware.starwaretrojan.dnschangerthanks!

Read other 2 answers

PLEASE NOTE: This is a DIFFERENT computer than the one I am currently working on with Agent ST

Because I was paranoid about this one, I ran an ESET Online scan to check my computer and it reported at several different trojans:

2 variants of Win32/InstallCore.D
and probably a few more.

I am not sure exactly how many because I inadvertently closed Internet Explorer before the scan completed.

I did not set ESET to remove anything that was found, I was just scanning.

So, here I am,,,,needing help for yet another computer in my house.

It seems to be running fine but since this is the one I use for working at home, communicating with clients, online banking, etc. I need to be sure it's clean.

I am a web developer so I am very familiar with Windows,etc. however, virus removal is not my expertise so I need to ask for help.

Here is the contents of the DDS.log

DDS (Ver_2011-08-26.01) - NTFSx86
Internet Explorer: 8.0.6001.18702 BrowserJavaVersion: 10.2.0
Run by Dona at 15:35:19 on 2012-02-10
Microsoft Windows XP Professional 5.1.2600.3.1252.1.1033.18.3326.2232 [GMT -5:00]
AV: AVG Anti-Virus Free Edition 2011 *Disabled/Updated* {17DDD097-36FF-435F-9E1B-52D74245D6BF}
============== Running Processes ===============
C:\WINDOWS\system32\svchost -k DcomLaunch
C:\WINDOWS\System32\svchost.exe -k nets... Read more

A:Need help with trojans..Win32/Toolbar.Zugo, Win32/InstallCore.D, JS/Agent.NDJ, Win32/TrojanDownloader.Tracur, Java/Agent.DU and...

Hi Dona!Peek a boo! Guess who?Can you try and zip up the GMER log file for me to review?---------------------Can you see if ESET Online Scanner dropped a log file in this location?Browse to this location: C:\Program Files\ESET\ESET Online Scanner\It should be named: log.txt if it was saved. If it is, please post that for me.---------------------You seem to have 2 versions of Skype installed. One of them seems to be a bit outdated.Lets remove that one now.You can go to the Control Panel and click on Add/Remove Programs and remove this one: Skype™ 4.1---------------------You're version of Firefox is also outdated by two versions. Open up Firefox and go to the Help menu click on About Firefox.It should check for updates, and download the updates that are required. Once it's completed downloading the update it'll present you with a button that says Apply Update. Please click on that. It will close Firefox and then apply the update to your computer.---------------------Please run these scans for me as well: Malwarebytes' Anti-Malware I see that you have Malwarebytes' Anti-Malware installed on your computer could you please do a scan using these settings: Open Malwarebytes' Anti-MalwareSelect the Update tabClick Check for UpdatesAfter the update have been completed, Select the Scanner tab.Select Perform quick scan, then click on ScanLeave the default options as it is and click on Start ScanWhen done, you will be pro... Read more

Read other 14 answers

(DDS log below)I re-installed my AV after running without it for a while and found that I had quite a few bad things going on picked up by Nod32 including (see attachment for more detail):Win32/Olmarik.ZCJava/TrojanDownloader.Agent.NBEa variant of Win32/Olmarik.UL trojanWin32/Cimag.CL trojanI also get multiple outbound connection attempts which are at least partially being blocked by Nod32 to weird .cc .cn and a few .com domain urls, this happens after performing a google search. Also getting some browser redirects going on and homepage changes.I tried setting nod32 to pre-release updates and performing a full scan, this picked up the above and removed them, but after a reboot there are still things going on. Before reading the steps on this site, I ran the latest ComboFix twice which picked up a rootkit in intelide.sys both times, but appears to come back each time. While I disabled nod32 when I ran ComboFix, it re-enabled upon reboot automatically, not sure if that matters.I've also been getting a startup delay of around 1 minute after logon, in this time, nothing appears to be going on (no apparent CPU or disk activity), but wireless, AV and other startup items do not run. Then a minute later, everthing fires up.I've tried running GMER several times but this keeps giving me a BSOD with IRQL_NOT_LESS_OR_EQUALLast scan with nod32 came up clean but still getting outbound connections and browser redirects.Looking to sort this out once and for all!DDS (Ver_10-03-17.... Read more

A:WinXP rootkit? problem + Win32/Olmarik.ZC Java/TrojanDownloader.Agent.NBE a variant of Win32/Olmarik.UL trojan Win32/Cimag.CL t...

Hi,Welcome to Bleeping Computer. My name is m0le and I will be helping you with your log.Please subscribe to this topic, if you haven't already. You can subscribe by clicking the Options box to the right of your topic title and selecting Track This Topic.Please avoid installing/uninstalling or updating any programs and attempting any unsupervised fixes or scans. This can make helping you impossible.Please reply to this post so I know you are there.The forum is busy and we need to have replies as soon as possible. If I haven't had a reply after 3 days I will bump the topic and if you do not reply by the following day after that then I will close the topic.----------------------------------------------Please download GMER from one of the following locations and save it to your desktop:Main MirrorThis version will download a randomly named file (Recommended)Zipped MirrorThis version will download a zip file you will need to extract first. If you use this mirror, please extract the zip file to your desktop.Disconnect from the Internet and close all running programs.Temporarily disable any real-time active protection so your security programs will not conflict with gmer's driver.Double-click on the randomly named GMER file (i.e. n7gmo46c.exe) and allow the gmer.sys driver to load if asked.Note: If you downloaded the zipped version, extract the file to its own folder such as C:\gmer and then double-click on gmer.exe.GMER will open to the Rootkit/Malware tab and perfor... Read more

Read other 14 answers

After start the laptop, (hidden) host.exe is consuming a lot of resources until crash. I can see and kill it with procesexplorer from Sysinternals.
I can't activate Windows Firewall, Malwarebytes show an error at coomputer start up and more...

When I start GMER it shows an error, it is attached.

Here the logs of DDS and GMER:
DDS (Ver_2011-08-26.01) - NTFSx86
Internet Explorer: 8.0.7601.17514 BrowserJavaVersion: 1.6.0_23
Run by sebastian at 16:41:18 on 2012-03-19
Microsoft Windows 7 Enterprise 6.1.7601.1.1252.54.1033.18.2925.1107 [GMT -3:00]
SP: Windows Defender *Disabled/Updated* {D68DDC3A-831F-4fae-9E44-DA132C1ACF46}
============== Running Processes ===============
C:\Windows\system32\svchost.exe -k DcomLaunch
C:\Windows\system32\svchost.exe -k RPCSS
C:\Windows\System32\svchost.exe -k LocalServiceNetworkRestricted
C:\Windows\System32\svchost.exe -k LocalSystemNetworkRestricted
C:\Windows\system32\svchost.exe -k netsvcs
C:\Windows\system32\svchost.exe -k LocalService
C:\Program Files\NVIDIA Corporation\Display\NvXDSync.exe
C:\Windows\system32\svchost.exe -k NetworkService
C:\Program Files\ASUS\ATK Package\ATK Hotkey\ASLDRSrv.ex... Read more

A:trojan-Dropper.win32.injector.ciwr | trojan.win32.agent2.faav | Virus.Win32.ZAccess.q

Hello sebamobile, Welcome to Bleeping Computer.
My name is fireman4it and I will be helping you with your Malware problem.

Please take note of some guidelines for this fix:
Refrain from making any changes to your computer including installing/uninstall programs, deleting files, modifying the registry, and running scanners or tools.
If you do not understand any step(s) provided, please do not hesitate to ask before continuing.
Even if things appear to be better, it might not mean we are finished. Please continue to follow my instructions and reply back until I give you the "all clean".
In the upper right hand corner of the topic you will see a button called Watch Topic.I suggest you click it and select Immediate E-Mail notification and click on Proceed. This way you will be advised when we respond to your topic and facilitate the cleaning of your machine.

Finally, please reply using the ADD REPLY button in the lower right hand corner of your screen. Do not start a new topic. The logs that you post should be pasted directly into the reply, unless they do not fit into the post.
I will be analyzing your log. I will get back to you with instructions.

Read other 14 answers

This virus was unknowingly attached to a game that was downloaded on my pc. I am using a different pc to post here as the virus prevents me from launching websites that offer support for its removal. Other posts that I have read recommend running an online scanner from eset. Unfortunately, for me, this would be one of the many sites the virus prohibits me from accessing. If I attempt to locate a help site from a search engine, I am redirected to other random sites. If I manually type the URL of a help site in the address bar, the site is blocked.I was able to run HijackThis and am providing this log. Any assistance that you can offer will be greatly appreciated.Logfile of Trend Micro HijackThis v2.0.2Scan saved at 4:59:04 PM, on 9/9/2008Platform: Windows XP SP2 (WinNT 5.01.2600)MSIE: Internet Explorer v7.00 (7.00.6000.16705)Boot mode: NormalRunning processes:C:\WINNT\System32\smss.exeC:\WINNT\system32\winlogon.exeC:\WINNT\system32\services.exeC:\WINNT\system32\lsass.exeC:\WINNT\system32\svchost.exeC:\WINNT\System32\svchost.exeC:\WINNT\system32\svchost.exeC:\WINNT\system32\spoolsv.exeC:\WINNT\system32\basfipm.exeC:\Program Files\Common Files\Symantec Shared\ccSetMgr.exeC:\Program Files\Cisco Systems\VPN Client\cvpnd.exeC:\WINNT\Explorer.EXEC:\Program Files\Symantec AntiVirus\... Read more

A:Trouble With Virus: Win32.agent.gvu / Trojan.downlader.agent.aejp

I apologize for the very long delay. We have a huge backlog of HijackThis Logs to handle and it has been taking us greater time than normal to get caught up. If you are still having a problem, and want us to analyze your information, please reply to this topic stating that you still need help and I will work with you on resolving your computer problems. If your problem has been resolved, please post a reply letting us know so we can close your topic.

Unfortunately, if I do not hear back from you within 5 days, I will be forced to close your topic. If you still need help after I have closed your topic, feel free to create a new one.

Once again, I apologize for the delay in responding to this topic.

Read other 1 answers

A friend's computer seems to be pretty riddled with viruses and adware. I went through the checklist and have cleared a lot out, but I'm not sure if the machine is clear yet. I definitely want to make sure there are no Trojans! Thanks in advance for any help.Here's the order of events: I was helping my friend with their computer and discovered that the entire C drive was shared. When I turned off sharing, AVG Free kicked in and said that a virus had been detected. Unfortunately I don't know the exact name of the virus, but it was a trojan of some kind. When I clicked the button to fix the problem, AVG returned an error. I installed Avast and did a boot scan, finding some viruses. I assume that the infected files in the McAfee SpamKiller folder were all intercepted prior to being stored there. I wasn't able to find much info on the infected folders in the system32 folder (Adware-gen). I also ran Ad-Aware and Spyware Search & Destroy, deleting everything they found (Ad-Aware I ran 3 times, until nothing showed up), and installed Comodo Firewall. I then ran the DSS scan. I ran the Kaspersky scan after that (sorry for doing it out of order, but I didn't think I'd have time for Kaspersky). I should mention that she uses a Russian version of Windows XP (I don't speak it, which made helping her interesting!). So, here is the order of the logs:1. Avast aswBoot.txt2. DSS main.txt3. DSS extra.txt4. Kaspersky03/30/2008 07:47Scan of all local drivesFile C:\WINDOWS\s... Read more

A:Infected With Trojan-proxy.win32.horst.te (others?)

Hi and welcome to Bleeping Computer! My name is Sam and I will be helping you.
I apologize for the delay getting to your log, the helpers here are very busy.

If you still need help, please post a fresh Hijackthis log, in this thread, so I can help you with your malware problems.
If you have resolved this issue please let us know.

Read other 8 answers

Hi, I?m a newbie and this is my first post. Thanks ahead of time for existing and for helping me!My computer is an HP,AMD Athlon 64x2, 1.0GB RAM, WIN XPsp2 desktop with lots of virus/Trojan/adware/malwareNot sure where they all came from but the surfing the web for fantasy football stuff yesterday morning and landing on www.athlonsports.[com] or www.grogansports.[com] was the final virus that started me crashing and generating the wonderful ?Error Message: Stop c000021a {Fatal System Error} The Session Manager Initialization System Process??After failing to reboot multiple times and not being able to use my XP recovery disks, the computer loaded up somehow in Normal Mode. I disconnected from the Internet and I ran Avast! Antivirus before it crashed again and it found the following virus/etc.Found by Avast! AntivirusJS:Redirector-B[Trj] in a temporary internet fileWMA:Wimad[Drp] in a temporary internet fileWin32:Monder-GB[Trj]? in ?c:windows\system32\opnmlccs.dll? file?Win32:Trojan-gen{Other}? in ?c:\Windows\system32\prunnet.exe? file ?Win32:adware-gen[Adw]? in a program that came with computer that I?ve never used: C:\program files\online services\peoplepc\isp5900\branding\ppal3ppc.exe\$instdir\ppcttoolbar.dllI deleted/quarantined those viruses and tried to do a system restore to a couple days before and it wouldn't let me do it although I had just saved a system restore on 12/31. And t... Read more

A:Win32:Monder-GB[Trj], Win32:Trojan-gen{Other}, Adware.PopCap, Trojan.Vundo, Trojan.Agent and more

Seneka Rootkit Please read this post by Quietman7http://www.bleepingcomputer.com/forums/ind...t&p=1074915and tell us how you want to procedeYou might want to procede with a partial cleanup so you can finish backing up those pictures

Read other 6 answers

For some reason this virus keeps coming back and with friends. I may have more than one of these viruses. Thank you ahead of time for your help.
DDS (Ver_09-06-26.01) - NTFSx86
Run by Administrator at 20:37:12.11 on Mon 07/06/2009
Internet Explorer: 8.0.6001.18702 BrowserJavaVersion: 1.6.0_13
Microsoft Windows XP Professional 5.1.2600.2.1252.1.1033.18.958.435 [GMT -5:00]

AV: ESET Smart Security 4.0 *On-access scanning enabled* (Updated) {E5E70D32-0101-4F12-8FB0-D96ACA4F34C0}
FW: ESET Personal firewall *enabled* {E5E70D32-0101-4340-86A3-A7B0F1C8FFE0}

============== Running Processes ===============

C:\WINDOWS\system32\svchost -k DcomLaunch
C:\WINDOWS\System32\svchost.exe -k netsvcs
C:\Program Files\ESET\ESET Smart Security\ekrn.exe
C:\WINDOWS\system32\svchost.exe -k imgsvc
C:\Program Files\ESET\ESET Smart Security\egui.exe
C:\Program Files\Google\Google Talk\googletalk.exe
C:\Program Files\Mozilla Firefox\firefox.exe
C:\Documents and Settings\Administrator\Desktop\dds.scr

============== Pseudo HJT Report ============... Read more

A:Infected with Win32/Agent.Pax trojan

Hello, Help21.My name is aommaster and I will be helping you with your log.I apologize for the delay in response we get overwhelmed at times but we are trying our best to keep up.If you have since resolved the original problem you were having would appreciate you letting us know. If not please perform the following below so I can have a look at the current condition of your machine.ThanksPlease note that I am in the process of my training so it may take a while for me to get back to you, as each of my fixes need to be checked by a coach first.We need to run RSITDownload random's system information tool (RSIT) by random/random and save it to your desktop.Double click on RSIT.exe.Click Continue at the disclaimer screen.Once it has finished, two logs will open. Please post the contents of both log.txt (<<will be maximized) and info.txt (<<will be minimized)In your next reply, please include the following:Log.txtinfo.txt

Read other 3 answers