Over 1 million tech questions and answers.


Q: VBS:ExeDropper-gen;Win32:Ramnit-B;Win32:Rootkit-gen;Win32:Trojan-gen

Hey I could use some help getting rid of this virus, I think Ramnit-A might be around too on it. I've done some researching trying to see if I could try and fix this on my own, but I think this might go quicker.I have spybot and adaware (freeware) on my computer, spybot hasn't bothered to pick anything up in this mess. Adaware has picked up Ramnit-A virus on the system and it always ends up with a list of items to repair (mostly files and a few processes at the end of the list), a cookie, and then ~4 misc. items that it recommends the "just once option". Anyways it hasn't been working, so from my reading, from a topic I managed to google from this forum board I downloaded Avast, which has grabbed virus file types that I listed in the topic with quick scan (and with it's "shields" too) . The other disturbing thing is that I think I have about 3000+ files now sitting in my virus chest on Avast from running the thing...safe to probably say it's not fixing anything.I'm a little worried too about the fact that the files Avast is taking are, or were just regular exe's some that were actually on my desktop. Has left me wondering if I should delete everything in the virus chest or not, I'm not going to end up deleting something important if I do? (main worry)From what I've read I hope I posted the required stuff, I'm currently running Gmer right now, I'll probably leave it running and try posting it tomorrow morning as it still has a ways to go. I don't know if you want the logs from Avast, they're pretty long lists. Well hopefully I'll hear from someone soon, and thanks to the one that ends up helping me out.p.s. have subscribed to topic already.

Preferred Solution: VBS:ExeDropper-gen;Win32:Ramnit-B;Win32:Rootkit-gen;Win32:Trojan-gen

I recommend downloading and running DAP. It can help sort out any driver and firmware related issues on your system

It's worked out well for many of us in the past.

You can download it direct from this link http://downloaddap.org. (This link will open the download page of DAP so you can save a copy to your computer.)

A: VBS:ExeDropper-gen;Win32:Ramnit-B;Win32:Rootkit-gen;Win32:Trojan-gen

Hello and welcome to Bleeping ComputerWe apologize for the delay in responding to your request for help. Here at Bleeping Computer we get overwhelmed at times, and we are trying our best to keep up. Please note that your topic was not intentionally overlooked. Our mission is to help everyone in need, but sometimes it takes just a little longer to get to every request for help. No one is ignored here.If you have since resolved the original problem you were having, we would appreciate you letting us know. If not please perform the following steps below so we can have a look at the current condition of your machine. Please include a clear description of the problems you're having, along with any steps you may have performed so far.Please refrain from running tools or applying updates other than those we suggest while we are cleaning up your computer. The reason for this is so we know what is going on with the machine at any time. Some programs can interfere with others and hamper the recovery process.Even if you have already provided information about your PC, we need a new log to see what has changed since you originally posted your problem.We need to create an OTL ReportPlease download OTL from one of the following mirrors:This is THE MirrorSave it to your desktop.Double click on the icon on your desktop.Click the "Scan All Users" checkbox.In the custom scan box paste the following:CODEmsconfigsafebootminimalactivexdrivers32netsvcs%SYSTEMDRIVE%\*.exe/md5starteventlog.dllscecli.dllnetlogon.dllcngaudit.dllsceclt.dllntelogon.dlllogevent.dlliaStor.sysnvstor.sysatapi.sysIdeChnDr.sysviasraid.sysAGP440.sysvaxscsi.sysnvatabus.sysviamraid.sysnvata.sysnvgts.sysiastorv.sysViPrt.syseNetHook.dllahcix86.sysKR10N.sysnvstor32.sysahcix86s.sysnvrd32.syssymmpi.sysadp3132.sysmv61xx.sysnvraid.sys/md5stop%systemroot%\*. /mp /s%systemroot%\system32\*.dll /lockedfiles%systemroot%\Tasks\*.job /lockedfiles%systemroot%\system32\drivers\*.sys /lockedfiles%systemroot%\System32\config\*.sav%systemroot%\system32\drivers\*.sys /90Push the button.Two reports will open, copy and paste them in a reply here:OTL.txt <-- Will be openedExtra.txt<--Will be minimizedIn the upper right hand corner of the topic you will see a button called Options. If you click on this in the drop-down menu you can choose Track this topic. I suggest you do this and select Immediate E-Mail notification and click on Proceed. This way you will be advised when we respond to your topic and facilitate the cleaning of your machine.After 5 days if a topic is not replied to we assume it has been abandoned and it is closed.regards myrti

Read other 2 answers

hey.really need help please. Avast is going crazy picking up trojans. And as its chest is now full of trojans its deleting ones. windows seems to be tring to install different things and then tels me it cant as msi files are missing. at the moment its a market research program trying to be installed, but its asking to load the disc as an msi. fileis not there. don't have market research stuff on the computer. it happens as soon as computer is turned on.and before we go further i am a novice at all this so please bear with me. thank you for your time.DDS (Ver_10-03-17.01) - NTFSx86 Run by elaine at 22:33:14.73 on 30/09/2010Internet Explorer: 8.0.6001.18702Microsoft Windows XP Home Edition 5.1.2600.3.1252.44.1033.18.1023.146 [GMT 1:00]AV: avast! Antivirus *On-access scanning enabled* (Updated) {7591DB91-41F0-48A3-B128-1A293FD8233D}============== Running Processes ===============C:\WINDOWS\system32\Ati2evxx.exeC:\WINDOWS\system32\svchost -k DcomLaunchsvchost.exeC:\WINDOWS\System32\svchost.exe -k netsvcssvchost.exesvchost.exeC:\Program Files\Alwil Software\Avast5\AvastSvc.exeC:\WINDOWS\system32\spoolsv.exesvchost.exeC:\Program Files\Common Files\Apple\Mobile Device Support\AppleMobileDeviceService.exeC:\Program Files\Bonjour\mDNSResponder.exeC:\WINDOWS\system32\svchost.exe -k hpdevmgmtC:\WINDOWS\system32\svchost.exe -k H... Read more

A:VBS:ExeDropper-gen (trj) and Win32:Ramnit B

Hello and welcome to Bleeping ComputerWe apologize for the delay in responding to your request for help. Here at Bleeping Computer we get overwhelmed at times, and we are trying our best to keep up. Please note that your topic was not intentionally overlooked. Our mission is to help everyone in need, but sometimes it takes just a little longer to get to every request for help. No one is ignored here.If you have since resolved the original problem you were having, we would appreciate you letting us know. If not please perform the following steps below so we can have a look at the current condition of your machine. Please include a clear description of the problems you're having, along with any steps you may have performed so far.Please refrain from running tools or applying updates other than those we suggest while we are cleaning up your computer. The reason for this is so we know what is going on with the machine at any time. Some programs can interfere with others and hamper the recovery process.Even if you have already provided information about your PC, we need a new log to see what has changed since you originally posted your problem.We need to create an OTL ReportPlease download OTL from one of the following mirrors:This is THE MirrorSave it to your desktop.Double click on the icon on your desktop.Click the "Scan All Users" checkbox.In the custom scan box paste the following:CODEmsconfigsafebootminimalactivexdrivers32netsvcs%SYSTEMDRIVE%\*.exe/md5st... Read more

Read other 9 answers

Hi,OK, I see I'm far from the first person with this nasty little bug. It's the first one I've ever been really hit with in years, so I'm particularly annoyed at it!So, on with the normal info: I was running AVG free (updated automatically) when it suddenly started sprouting alerts. For some reason I thought it was AVG with some false positives, as it was getting the hits for the VBS-ExeDropper virus, even on files that I was pretty sure wouldn't have an issue, including some that I'd written myself (I'm a developer). So I unisntalled AVG, and installed Avast, which is now gradually filling the chest.I've attached the DDS and GMER logs.Also, following some advice here, I ran RKUnHooker, with the result attached.Any help with this will be greatly appreciated.QUICK EDIT AFTER INITIALLY POSTING THIS:Rundll32 was being used to run something called gedpct.dll. I couldn't find any reference on this, and it's in the chest anyway. Not sure if that's important or not.Regards,Andy

A:Win32:Ramnit-B and VBS-ExeDropper-gen [Trj]

hi BlakeyUK,Your post is a few days old, if you still need help simply reply back.

Read other 3 answers

Hi As the title suggests my laptop is infected with win32:Ramnit-B and VBS:Exedropper-gen. I noticed something wasn't right when AVG started flagging it up. Initially thought it was a load of false positives and so tried avast and sure enough they detected 'it' also. Ran a scan... 3000 files infected. Mostly htm. html and dlls. I have be able to get a 'clean' scan with malwarebytes in safe mode after several scans a reboots but on restarting in normal mode with all the infected files it just comes back.As of now the laptop is running fine though. No real problems with it.Naturally I would like to remove this issue rather than reformatting. Or at least try before starting over.Have a few questions:Do we know in advance whether infected files can be save/repaired or not? I have read of people fixing the html files but what about the dll etcs? Or is it a case of; we maybe able to repaire the laptop but those files are done and will have to be deleted?Re: Backing UP. Have backed up my latest files to a memory stick but I am guessing they will contain the infection too. Should I go through each file before backing it up to check for infection and back those up rather than just pulling the non-infected stuff off it later? i.e will that just reinfect a clean laptop/pc? Can I be sure of what files it does not infect. i.e if its not in the Avast scan list can I assume that file type as a whole hasn't been infected.If we do need to reformat later on. My Laptop... Read more

A:Infected With: win32:Ramnit-B and VBS:Exedropper-gen

Hello and welcome to Bleeping ComputerWe apologize for the delay in responding to your request for help. Here at Bleeping Computer we get overwhelmed at times, and we are trying our best to keep up. Please note that your topic was not intentionally overlooked. Our mission is to help everyone in need, but sometimes it takes just a little longer to get to every request for help. No one is ignored here.If you have since resolved the original problem you were having, we would appreciate you letting us know. If not please perform the following steps below so we can have a look at the current condition of your machine. If you have not done so, include a clear description of the problems you're having, along with any steps you may have performed so far.Upon completing the steps below another staff member will review and take the steps necessary with you to get your machine back in working order clean and free of malware.If you have already posted a DDS log, please do so again, as your situation may have changed.Use the 'Add Reply' and add the new log to this thread.Thanks and again sorry for the delay.We need to see some information about what is happening in your machine. Please perform the following scan:Download DDS by sUBs from one of the following links. Save it to your desktop.DDS.scrDDS.pifDouble click on the DDS icon, allow it to run.A small box will open, with an explaination about the tool. No input is needed, the scan is running.Notepad will open with the ... Read more

Read other 8 answers

HI there

I could really use some help!

I use Avast 5 and its up to date and while surfing a warez site last night (I know..) Avast started throwing up several warning messages that it was blocking Win32:Ramnit-G & VBS:Exedropper-gen viruses. Then a message warning of imminent hard drive failure. When I returned to my desktop, all the files had disappeared including 'my computer', 'recycle bin' shortcuts etc and all my personal folders (documents, downloads, music, videos - the ones built in to your user profile). I did a quick avast scan which dealt with several viruses and using the search bar i could still access files and folders that were otherwise hidden. I ran a full avast boot scan (which moved to chest 64 trojans) and when i rebooted, the issue remained but now i couldn't access missing files/folders through the search bar. Tried cmd prompt and opening in safe mode but issue remains. Haven't been able to back any files up but I know they're still there. I can use photoshop for example, and access recently opened jpegs (which are otherwise hidden) ditto with winamp. I can access program files no problem and hard drive percentage is exactly the same as it always was. Tried full Panda online scan. Tried a full MBAM scan. Ran checkdisk in case there were issues with the drives but they're fine. No system restore points either. I've also tried registry mechanic to fix some reg errors. My system seems to free of the viruses but obviously it isn't! I use Win7 32 and i'... Read more

A:Win32:Ramnit-G & VBS:Exedropper-gen virus problem.

Hello, Welcome to TSF.
I'm nasdaq and will be helping you.

You may wish to Subscribe to this thread (Thread Tools > Subscribe to this thread) so that you are notified when you receive a reply.

Please read these instructions carefully and then print out or copy this page to Notepad in order to assist you when carrying out the fix.

Note that the fix may take several posts. Please continue to respond to my instructions until I confirm that your logs are clean. Remember that although your symptoms may vanish, this does NOT mean that your system is clean.

If there is anything you don't understand, please ask BEFORE proceeding with the fixes.

Please ensure that you follow the instructions in the order I have them listed.

Please do not install or uninstall any programs, or run any other scanners or software, unless I specifically ask you to do so. Also please copy and paste logs into the thread, rather than add them as attachments.

To make your files visible again, please download the following program to your desktop:


Once the program has been downloaded, double-click on the Unhide.exe icon on your desktop and allow the program to run. This program will remove the +H, or hidden, attribute from all the files on your hard drives. If there are any files that were purposely hidden by you, you will need to hide them again after this tool is run.

This may take sometime, please let if finish.

Please download ComboFix from any of... Read more

Read other 8 answers

My Avast antivirus recently started detecting a whole host of viruses. I ran a thorough scan of all files and deleted every infected file until the scanner turned up a hit in the operating memory. It then suggested I run a boot sector scan - I did so. Upon rebooting Avast started detecting more viruses. This time I rebooted into Safe Mode and ran the scanner there, deleting everything I found. Apparently one of the files I deleted was important, because after that my computer Blue-Screened during boot-up and I had to do a system restore to a save point from a few days ago (before the virus was contracted). Since then the virus has continued to crop up, and I haven't the foggiest notion of how to get rid of it.

The title is a list of the virus descriptions that my Avast scanner gave me. I ran all the programs the walkthrough on this site instructed me to, but the RootRepeal program crashed and generated an error message and crash report, both attached (error message in .png image format - I took a screenshot of it).

Thanks for your help!

DDS (Ver_09-12-01.01) - NTFSx86
Run by Bryan at 18:56:06.09 on Wed 12/02/2009
Internet Explorer: 8.0.7600.16385 BrowserJavaVersion: 1.6.0_17
Microsoft Windows 7 Home Premium 6.1.7600.0.1252.1.1033.18.3070.1546 [GMT -5:00]
============== Running Processes ===============

C:\Windows\system32&... Read more

A:Infected with js: downloader-FT Win32:Banload-GLR Win32:Malware-gen Win32:Refpron-AW Win32:Rootkit-gen Win32:VB-NWC

Hello and welcome to Bleeping ComputerWe apologize for the delay in responding to your request for help. Here at Bleeping Computer we get overwhelmed at times, and we are trying our best to keep up. Please note that your topic was not intentionally overlooked. Our mission is to help everyone in need, but sometimes it takes just a little longer to get to every request for help. No one is ignored here.If you have since resolved the original problem you were having, we would appreciate you letting us know. If not please perform the following steps below so we can have a look at the current condition of your machine. If you have not done so, include a clear description of the problems you're having, along with any steps you may have performed so far.Upon completing the steps below another staff member will review and take the steps necessary with you to get your machine back in working order clean and free of malware.If you have already posted a DDS log, please do so again, as your situation may have changed.Use the 'Add Reply' and add the new log to this thread.Thanks and again sorry for the delay.We need to see some information about what is happening in your machine. Please perform the following scan:Download DDS by sUBs from one of the following links. Save it to your desktop.DDS.scrDDS.pifDouble click on the DDS icon, allow it to run.A small box will open, with an explaination about the tool. No input is needed, the scan is running.Notepad will open with the results.Foll... Read more

Read other 3 answers

Hi all.

I found this forum and read some of the excellent advice but not before I (unfortunately) tried quite a few other methods. Malwarebytes has been the only program to consistantly reveal a trojan but cannot delete or replace the infected files. My problems started after F-secure picked up a virus (via a Windows Media Player file I believe) but then went haywire afterwards, forcing me to uninstall it. My symptoms are:
Licosearch random redirect from browsers
C: and D: (both hard drives) are hiding folders preventing me from accessing them, except via another program such as Revo Uninstall Pro.
IE and Firefox are blocked from accessing most anti-virus sites
cannot boot to safe mode (when selecting any of the safe modes, windows simply restarts as usual, not in safe mode)
Occasionally, explorer.exe appears not to load, sending the PC into a cycle of rebooting until the desktop eventually appears
C:\Program Files\sielwvsv\blvxhvcm.exe is shown as a trojan by malwarebytes but will not delete. This appears on the 'userinit' registry entry and the register cannot be modified either. (I amateurishly changed the program file name to 'trojan' and 'trojan2' but to no avail, as you'll see in the logs).
Malwarebytes will discover new trojans if the PC is left running for a while
I have been accessing the internet from another PC for reliability, though nearly infected the other one when I used a datastick to transfer the dds and gmer .txt files to it (the stick has a 'RECYCLER' f... Read more

A:Licosearch re-direct, Trojan.Win32.LeBag!IK, Win32.Ramnit

Attached is the zip file for part of the D drive as mentioned in the OP.

Read other 10 answers

Hi,Please help me in getting rid of the pop ups which keep coming up.trojan downloader win32 agent bqtrojan clicker win32 tiny htrojan spy win32 key logger.aatrojan spy win32 green screentrojan spy html bankfraud.dqHijakThis log file.Logfile of Trend Micro HijackThis v2.0.2Scan saved at 15:00:40, on 9/8/2008Platform: Windows XP SP2 (WinNT 5.01.2600)MSIE: Internet Explorer v7.00 (7.00.6000.16705)Boot mode: NormalRunning processes:C:\WINDOWS\System32\smss.exeC:\WINDOWS\system32\csrss.exeC:\WINDOWS\system32\winlogon.exeC:\WINDOWS\system32\services.exeC:\WINDOWS\system32\lsass.exeC:\WINDOWS\system32\svchost.exeC:\WINDOWS\system32\svchost.exeC:\WINDOWS\System32\svchost.exeC:\WINDOWS\system32\svchost.exeC:\WINDOWS\system32\svchost.exeC:\Program Files\Common Files\Symantec Shared\ccProxy.exeC:\Program Files\Common Files\Symantec Shared\ccSetMgr.exeC:\Program Files\Symantec Client Security\Symantec Client Firewall\ISSVC.exeC:\Program Files\Common Files\Symantec Shared\SNDSrvc.exeC:\Program Files\Common Files\Symantec Shared\SPBBC\SPBBCSvc.exeC:\Program Files\Common Files\Symantec Shared\ccEvtMgr.exeC:\WINDOWS\system32\spoolsv.exeC:\WINDOWS\Explorer.EXEC:\Program Files\Hewlett-Pac... Read more

A:Infected With Trojan Clicker Win32 Tiny.h / Downloader Win32 Agent Bq / Spy Win32 Key Logger.aa/spy Win32 Green Screen / Html B...

Sorry for the delay. If you are still having problems please post a brand new HijackThis log as a reply to this topic. Before posting the log, please make sure you follow all the steps found in this topic:Preparation Guide For Use Before Posting A Hijackthis LogPlease also post the problems you are having.

Read other 1 answers

hello. sorry about this mess. im afraid i dont really know what im doing. my nephew asked me to help get rid of a red circle with a white cross telling him he had spyware but its turned into something much worse. he only used windows firewall and nothing else saying he only uses world of warcraft and msn and music and doesnt surf the web!! i tried to scan with avg but it was aborted and the windows firewall was continually turned off no matter how many times i put it on. tried other antivirus progs but all were turned off. eventually i managed to do online scan on microsoft safety centre and deleted quite a few v high threat trojans but many unable to clean. i also ran sophos rootkit and nearly gave myself a heart attack - 938 hidden things that recommend not to clean. i resorted to you now. i followed the tutorial for posting hijack this and here are the resultskaspersky report for critical areas--------------------------------------------------------------------------------KASPERSKY ONLINE SCANNER 7 REPORT Saturday, November 29, 2008 Operating System: Microsoft Windows XP Professional Service Pack 3 (build 2600) Kaspersky Online Scanner 7 version: Program database last update: Saturday, November 29, 2008 12:40:36 Records in database: 1426420--------------------------------------------------------------------------------Scan settings: Scan using the following database: extended Scan archives: yes Scan mail databases: yesScan area - Critical Areas: C:\Do... Read more

A:win32/alureon.gen, win32/Eldycow.en!A, win32/Small, win32/Olmafik, winNT/Xantvi.gen!A, Trojan-Game Thief and more

i think i have sorted this. i ran SDFix which cleaned up enough for me to install antivirus. avast caught lots of trojans and i have now been able to onlinescan and spybot s/d etc. all logs now coming back clean so can u delete this post please

Read other 3 answers

Hello,My computer became infected last night, and It's pretty bad. I became infected with Infected: Trojan:Win32/Alureon.BT, Win32:Jifas-CY, and the others listed (maybe more). Long story short, I'd just watched Harry Potter on dvd, and logged onto the computer to see who he married in the end. I ended up at a Harry Potter encyclipdiea website, and looked it up. Avast went nuts after a few minutes, and showed 4 different virus alerts, and Windows Defender showed 1 as well after I shut down.The virus listed by Defender was Trojan:Win32/Alureon.BT. Avast listed Win32:Jifas-CY, I didn't get the others in time.The last 2 I listed in the title, a "security center alert" claimed it detected these programs trying to acess the internet. It listed one more, but I didn't get it's name in time.I know Alureon is a downloader and backdoor for other viruses, and it basically shuts down security systems, which it's trying to do since windows now thinks I have no anti-virus installed.All of these trojans are listed as "server" and "high risk." I'm not sure a root kit didn't try to make it's way in too.EDIT: I wanted to add a few things in. First, I have XP SP3 set up with multiple accouts, one admin "owner" account and then 1 limited access "user" account. The Viruses came in while the user account was logged on (I am not dumb enough to connect to the internet with an admin account). It seems the Viruses we... Read more

A:Infected: Trojan:Win32/Alureon.BT, Win32:Jifas-CY, Backdoor.Win32.Kbot.al, Net-Worm.Win32.Mytob.t

Hello again.I booted into Safe Mode and ran an Avast scan (which took forever) and it was a waste of time. The stupid thing found nothing wrong, and said the system was clean (which is the opposite it says when you log into the limited user account). The computer (and specially that account at least) is definitely infected. Could the viruses be hiding themselves when in safe mode?Should I scan from a Pre-install environment like BartPE? Or from the Regular "Owner" Admin account? I waited 2 days for the stupid program to scan 700gb (painfully slow for a qaud core, though to be excepted in safe mode), and it was useless.Other than running windows defender (which I'm doing now), and maybe trying MBAM, I'm not sure what to do. I'm not expect enough to dive into programs like OTViewIT and Combofix, so I'll need help here. Please, ANY HELP is appreciated. I would rather NOT wipe the drive and reinstall the whole system, but I need to get this figured out.Does no one have any ideas???

Read other 5 answers

(DDS log below)I re-installed my AV after running without it for a while and found that I had quite a few bad things going on picked up by Nod32 including (see attachment for more detail):Win32/Olmarik.ZCJava/TrojanDownloader.Agent.NBEa variant of Win32/Olmarik.UL trojanWin32/Cimag.CL trojanI also get multiple outbound connection attempts which are at least partially being blocked by Nod32 to weird .cc .cn and a few .com domain urls, this happens after performing a google search. Also getting some browser redirects going on and homepage changes.I tried setting nod32 to pre-release updates and performing a full scan, this picked up the above and removed them, but after a reboot there are still things going on. Before reading the steps on this site, I ran the latest ComboFix twice which picked up a rootkit in intelide.sys both times, but appears to come back each time. While I disabled nod32 when I ran ComboFix, it re-enabled upon reboot automatically, not sure if that matters.I've also been getting a startup delay of around 1 minute after logon, in this time, nothing appears to be going on (no apparent CPU or disk activity), but wireless, AV and other startup items do not run. Then a minute later, everthing fires up.I've tried running GMER several times but this keeps giving me a BSOD with IRQL_NOT_LESS_OR_EQUALLast scan with nod32 came up clean but still getting outbound connections and browser redirects.Looking to sort this out once and for all!DDS (Ver_10-03-17.... Read more

A:WinXP rootkit? problem + Win32/Olmarik.ZC Java/TrojanDownloader.Agent.NBE a variant of Win32/Olmarik.UL trojan Win32/Cimag.CL t...

Hi,Welcome to Bleeping Computer. My name is m0le and I will be helping you with your log.Please subscribe to this topic, if you haven't already. You can subscribe by clicking the Options box to the right of your topic title and selecting Track This Topic.Please avoid installing/uninstalling or updating any programs and attempting any unsupervised fixes or scans. This can make helping you impossible.Please reply to this post so I know you are there.The forum is busy and we need to have replies as soon as possible. If I haven't had a reply after 3 days I will bump the topic and if you do not reply by the following day after that then I will close the topic.----------------------------------------------Please download GMER from one of the following locations and save it to your desktop:Main MirrorThis version will download a randomly named file (Recommended)Zipped MirrorThis version will download a zip file you will need to extract first. If you use this mirror, please extract the zip file to your desktop.Disconnect from the Internet and close all running programs.Temporarily disable any real-time active protection so your security programs will not conflict with gmer's driver.Double-click on the randomly named GMER file (i.e. n7gmo46c.exe) and allow the gmer.sys driver to load if asked.Note: If you downloaded the zipped version, extract the file to its own folder such as C:\gmer and then double-click on gmer.exe.GMER will open to the Rootkit/Malware tab and perfor... Read more

Read other 14 answers

Hi, im having a problem with popups. When I run Avast it finds files and gets rid of them but it seems that every time i do a scan it picks up something new. here is a list of the files its deleted so far.

A0007433.dll win32:trojan-gen
A0007484.dll win32:rootkit-gen
A0007485.dll win32:adware-gen
geBqQJYp.dll win32:trojan-gen
pmnOHXoL.dll win32:rootkit-gen
trz1.tmp win32:rootkit-gen
tuvvpjgd.dll win32:adware-gen

here is the DDS log

DDS (Ver_09-01-19.01) - NTFSx86
Run by Administrator at 7:09:47.25 on Mon 01/26/2009
Internet Explorer: 7.0.5730.13
Microsoft Windows XP Professional 5.1.2600.3.1252.1.1033.18.510.250 [GMT -5:00]

AV: avast! antivirus 4.8.1296 [VPS 090125-0] *On-access scanning disabled* (Updated)

============== Running Processes ===============

C:\WINDOWS\system32\svchost -k DcomLaunch
C:\WINDOWS\System32\svchost.exe -k netsvcs
C:\WINDOWS\system32\svchost.exe -k WudfServiceGroup
C:\Program Files\Alwil Software\Avast4\aswUpdSv.exe
C:\Program Files\Alwil Software\Avast4\ashServ.exe
C:\Program Files\Common Files\Apple\Mobile Device Support\bin\AppleMobileDeviceService.exe
C:\Program Files\Bonjour\mDNSResponder.exe
C:\Program Files\Java\jre6\bin\jqs.exe
C:\WINDOWS\system32\svchost.exe -k imgsvc
C: ... Read more

A:Pop ups, win32:trojan-gen, win32:adware-gen, win32:rootkit-gen

Please make sure you disable ALL of your Antivirus/Antispyware/Firewall before running ComboFix.. Please visit HERE if you don't know how.. Please re-enable them back after performing all steps given..Please download ComboFix by sUBs from one of the locations below, and save it to your Desktop.Link 1Link 2Link 3Double click combofix.exe and follow the prompts. Please, never rename Combofix unless instructed.If ComboFix asked you to install Recovery Console, please do so.. It will be your best interest..When finished, it shall produce a log for you. Post that log and a fresh HijackThis log in your next reply..Note: DON'T do anything with your computer while ComboFix is running.. Let ComboFix finishes its job..

Read other 8 answers

Hello, Ive been fowarded from Bronis care(Security > Am I infected? What do I do? forum) as stated "...at this point some more advanced tools (not allowed in this forum) will be needed to clean up your computer.
With the information you have provided I believe you will need help from the malware removal team."

thread link

I dont know the name of the infection but Spybot found Win32.AVKillsvc.e which it keeps fixing & keeps showing back up.
AVG cannot be accessed or found but did just previously find Trojan Horse Backdoor.Generic.UFQ & Win32\Cryptor. There was also a popup of something like- "Microsoft Feeds Update needed" or something? and there was a message something like- "Windows is not your operating program"?

I couldnt connect to internet (wireless) but Broni seems to have sorted that out so now I am able to but GMER(which did fully scan with Broni, using UBB flash for download) now cuts out. I was able to stop & copy the scan before the cut point & will include that log which may be incomplete (see previous full scan log posted on previous thread) Other logs also posted on that thread may be helpful.
Thanks in advance for trying to get me through this part! Cat

Here is the DDS:

DDS (Ver_2011-08-26.01) - NTFSx86
Internet Explorer: 7.0.5730.13
Run by Owner at 23:27:46 on 2011-09-05
Microsoft Windows XP Home Edition 5.1.2600.2.1252.1.1033.18.95... Read more

A:fwd from Broni- nasty rootkit! Win32.AVKillsvc.e - Rootkit.Win32.ZAccess.e - Win32\Cryptor

Hello and Welcome to the forums! My name is Gringo and I'll be glad to help you with your computer problems. Somethings to remember while we are working together.Do not run any other tool untill instructed to do so!please Do not Attach logs or put in code boxes.Tell me about any problems that have occurred during the fix.Tell me of any other symptoms you may be having as these can help also.Do not run anything while running a fix.Do not run any other tool untill instructed to do so!Click on the Watch Topic Button and select Immediate Notification and click on proceed, this will help you to get notified faster when I have replied and make the cleaning process faster.Please print out or make a copy in notpad of any instructions given, as sometimes it is necessary to go offline and you will lose access to them.Run Combofix:You may be asked to install or update the Recovery Console (Win XP Only) if this happens please allow it to do so (you will need to be connected to the internet for this)Before you run Combofix I will need you to turn off any security software you have running, If you do not know how to do this you can find out >here< or >here<Combofix may need to reboot your computer more than once to do its job this is normal.You can download Combofix from one of these links.Link 1Link 2Link 3 1. Close any open browsers or any other programs that are open.2. Close/disable all anti virus and anti malware programs so they do not interfere with the r... Read more

Read other 43 answers

HiWanted to start off by saying you guys in this forum are awesome. Thanks for all your help and expertise, you guys are honestly a godsend. I say this because following someone else's case in the forums has helped me. I was on the verge of formatting and re-installing and now my computer is usable. Beginning with viruses that have been causing blue screens for the last three days, they have pretty much all stopped now. The only issue I have now is sometimes my computer would slow right down. Watching videos or listening to audio it would drag, stagger, pause. I have not used any other programs yet, so I haven't seen the effects in anything other than my internet browser. Perhaps the GMER scan took longer as well. Task manager shows cpu and mem usage as quite normal and not peaking.The steps I have used up to this point:1. Scanned with Microsoft Security Essentials. Detected Trojan:Win32.RimecudA2. Scanned with Kaspersky Rescue Disk. Removed quite a few things. I think I have logs.3. Scanned with Malwarebyte's Anti-Malware.It couldn't remove Trojan.Bubnix which appeared as a chmnoti.sys file in my Windows/System32/drivers folder. It would say it needed to restart the computer and upon restarting the file would still be in there.I moved it onto my Ubuntu desktop and it's still there atm. Probably not the best way to do it, but I'm going to assume it's not going to do anything sitting there for now.After this, the blue screens would still appear when... Read more

A:Disinfected Trojan.Bubnix and Rootkit.Win32.TDSS.tdl4. Still have Win32.Palevo

Hi,Welcome to Bleeping Computer. My name is m0le and I will be helping you with your log.Please subscribe to this topic, if you haven't already. Click the Watch This Topic button at the top on the right.

Please avoid installing/uninstalling or updating any programs and attempting any unsupervised fixes or scans. This can make helping you impossible.

Please reply to this post so I know you are there.The forum is busy and we need to have replies as soon as possible. If I haven't had a reply after 3 days I will bump the topic and if you do not reply by the following day after that then I will close the topic.Once I receive a reply then I will return with your first instructions.Thanks

Read other 18 answers

I've been fighting agains this little menace for the last couple of days now.
No success.

I was infected through a torrent file (wasn?t cautious enough...), using AVG 9.0 paid version.
Since then I've try them all (practically), since NOD32, Kaspersky Internet Security, Malwarebytes (...) to Microsoft Security Essentials.
Kaspersky was the only one who could delete it (at least I thought so), but then my PC couldn't reboot itself, so then I was forced to restore the system and the virus was back in active!

For what it counts, I do have access to my Windows install disc.

Your specialized help is my last hope before I decide to format my Pc.
So thanks in advance for all you can do.

Ark.txt and Attach.txt attached at the bottom.

Here's the DDS Scan:

DDS (Ver_09-10-13.01) - NTFSx86
Run by Zootopia at 15:23:45,52 on 23-10-2009
Internet Explorer: 8.0.7600.16385
Microsoft Windows 7 Home Premium 6.1.7600.0.1252.351.1046.18.2047.1090 [GMT 1:00]

============== Running Processes ===============

C:\Windows\system32\svchost.exe -k DcomLaunch
C:\Windows\system32\svchost.exe -k RPCSS
c:\Program Files\Microsoft Security Essentials\MsMpEng.exe
C:\Windows\System32\svchost.exe -k LocalServiceNetworkRestricted
C:\Windows\System32\svchost.exe -k LocalSystemNetworkRestricted
C:\Windows\system32\svchost.exe -k netsvcs
C:\Program Files\Creative\Shared Fi... Read more

A:VIRUS ISSUE: Rootkit.Win32.TDSS.u / Trojan:Win32/Alureon.gen!U



Read other 2 answers

I've been fighting agains this little menace for the last couple of days now.
No success.

I was infected through a torrent file (wasn´t cautious enough...), using AVG 9.0 paid version.
Since then I've try them all (practically), since NOD32, Kaspersky Internet Security, Malwarebytes (...) to Microsoft Security Essentials.
Kaspersky was the only one who could delete it (at least I thought so), but then my PC couldn't reboot itself, so then I was forced to restore the system and the virus was back in active!

For what it counts, I do have access to my Windows install disc.

Your specialized help is my last hope before I decide to format my Pc.
So thanks in advance for all you can do.

Read other answers

Hello,My name is Raj and I am a new member to this forum. Let me thank you, first of all, for all the help you all provide with solving these nasty issues. Now here is my situation.My problems started when my IE web pages did not load inspite of having good wireless connection. I ran AVG free and got the web browsing back. But then my CMD and regEdit tools would not work. I ran Spybot S&D but it did fix my issue. In addition my desktop stopped loading. I could use ctrl+alt+delete to get task manager and then use File -> Create New task to run explorer.exe. This would get my desktop back but only intermittently. Then I decided to buy Kaspersky. I was totally disappointed with it. It detected several malware but it could not cure Trojan-Clicker.win32.delf.cbe and Rootkit.win32.podnuha.a infections. It would try to delete these files, ask me to restart the computer and would not delete the files after the restart. Each time I restart the computer, it would detect these, try to delete, ask me to restart and the cycle continued. On top of the I lost my CMD and reggedit tools again. I tried to run dds.scr with the hope of getting you all the dds logs but my CMD tool does not work. In addtion whenever I tried to run 'cmd' I would lose my desktop (if I happend to get it back comehow).So instead of giving you attach.txt I can only give HT logs at this point. Hope you can help me out and I appreciate your help very much.ThanksRaj P.S : I could not attached the log... Read more

A:Trojan-Clicker.win32.delf.cbe and Rootkit.win32.podnuha.a infections

Hello! My name is Sam and I will be helping you. In order to see what's going on with your computer I will ask for you to post various logs from the tools that we will use to resolve your issue. Please also share with me any information about how your computer is reacting and behaving each step of the way as we work through this process.We need to create an OTListIt2 ReportPlease download OTListIt2 from hereSave it to your desktop.Double click on the icon on your desktop.Click the "Scan All Users" checkbox.Push the "Run Scan" button.The scan should take just a few minutes.Copy the log that opens up and paste it back here in your next reply.=============The next log will show us any hidden files that are present.Download GMER from here:Unzip it to the desktop.Open the program and click on the Rootkit tab.Make sure all the boxes on the right of the screen are checked, EXCEPT for ?Show All?.Click on Scan.When the scan has run click Copy and paste the results (if any) into this thread.

Read other 12 answers

Hello, I was infected with a virus and didn't have any protection on my PC. I went out and bought Kaspersky Internet Security 2009. My original problem was that the virus was not allowing me to surf the internet with out popups and redirects. After running the Kaspersky software it cleaned up a bunch of issues but has gotten to a point were it cannot clean the last two issues. It recognizes them and marks them for deletion but asks me to reboot in order to delete. After I reboot it just finds the viruses again and I repeat the process endlessly.

I went through some troubleshooting steps with a Kaspersky rep and she decided that she had exhausted all options and asked me to format the computer. That is not an option and I don't believe that there is no hope of cleaning the virus. I am in need of someone with a little more expertise and vigilance.

The two issues are described below as listed by the Kaspersky software:
1. Trojan-Cliker.win32.delf.cbe - Object: C:\windows\system32\gznvqkei.dll
2. Rootkit.win32.Podnuha.a - Object: System Memory

When I try to manually delete the gznvqkei.dll file I get an "Access Denied" error.

The Kaspersky rep did have me run the combofix software but it did not solve the issue. She had me run a custom script from within the AV software that was designed to delete the troubled files to no avail. She also had me create a boot disk but when using the boot disk it does not recognize my hard drive so ... Read more

A:2 Infected - Rootkit.win32.Podnuha.a and Trojan-Cliker.win32.delf.cbe

Probably you best chance is to submit a HJT logPlease read the pinned topic titled "Preparation Guide For Use Before Posting A Hijackthis Log". If you cannot complete a step, then skip it and continue with the next. In Step 6 there are instructions for downloading and running DDS which will create a Pseudo HJT Report as part of its log.When you have done that, post your log in the HijackThis Logs and Malware Removal forum, NOT here, for assistance by the HJT Team Experts. A member of the Team will walk you through, step by step, on how to clean your computer. If you post your log back in this thread, the response from the HJT Team will be delayed because your post will have to be moved. This means it will fall in line behind any others posted that same day. Start a new topic, give it a relevant title and post your log along with a brief description of your problem, a summary of any anti-malware tools you have used and a summary of any steps that you have performed on your own. An expert will analyze your log and reply with instructions advising you what to fix. After doing this, we would appreciate if you post a link to your log back here so we know that your getting help from the HJT Team.Please be patient. It may take a while to get a response because the HJT Team members are very busy working logs posted before yours. They are volunteers who will help you out as soon as possible. Once you have made your post and are waiting, please DO NOT "bump" your post or make another r... Read more

Read other 3 answers

Hello, I was told to post here by the moderator. Here's the scoop: I was infected with a virus and didn't have any protection on my PC. I went out and bought Kaspersky Internet Security 2009. My original problem was that the virus was not allowing me to surf the internet with out popups and redirects. After running the Kaspersky software it cleaned up a bunch of issues but has gotten to a point were it cannot clean the last two issues. It recognizes them and marks them for deletion but asks me to reboot in order to delete. After I reboot it just finds the viruses again and I repeat the process endlessly.

I went through some troubleshooting steps with a Kaspersky rep and she decided that she had exhausted all options and asked me to format the computer. That is not an option and I don't believe that there is no hope of cleaning the virus. I am in need of someone with a little more expertise and vigilance.

The two issues are described below as listed by the Kaspersky software:
1. Trojan-Cliker.win32.delf.cbe - Object: C:\windows\system32\gznvqkei.dll
2. Rootkit.win32.Podnuha.a - Object: System Memory

When I try to manually delete the gznvqkei.dll file I get an "Access Denied" error.

The Kaspersky rep did have me run the combofix software but it did not solve the issue. She had me run a custom script from within the AV software that was designed to delete the troubled files to no avail. She also had me create a boot disk but when using the boot d... Read more

A:2 Infected - Rootkit.win32.Podnuha.a and Trojan-Cliker.win32.delf.cbe

Hello dmacc01.If you still have the same issues, you may consider the following. But first, be absolutely aware that having the system without an antivirus program is an extremely dangerous thing.Let's have you create a restore point (at this time). 1. Right click the My Computer icon on the Desktop and click on Properties.2. Click on the System Restore tab.3. If there is a check mark next to "Turn off System Restore on all drives", then click on the line to clear it.4. If C is your system drive (as it is in most cases) and you see other drives monitored in the list (like D, E, etc) click on the other drives, press Settings button, and get the other drives turned off.5. we only want to monitor the drive with Windows o.s.If you are unable to activate System Restore or if the service is disabled, then.....from the Start button > RUN option .... type in services.msclook for System Restore serviceIf it is listed as off or inactive, press on the link at top left to Start it.Next, See and do as outlined here http://bertk.mvps.org/html/createrp.htmlAfter that, also do this:1. Go >> Here << and download ERUNT (ERUNT (Emergency Recovery Utility NT) is a free program that allows you to keep a complete backup of your registry and restore it when needed.)2. Install ERUNT by following the prompts (use the default install settings but say no to the portion that asks you to add ERUNT to the start-up folder, if you like you can enable this option later)3. Start ERUNT... Read more

Read other 4 answers

Hello, my computer has become overrun with the above named virus and worm. I would greatly appreciate any assistance and severely do need help.Machine: 1 year old Dell Inspiron DesktopOS: Windows XPSecurity Software: Prevx, Malwarebytes Anti-Malware, and Microsoft Security Essentials.Symptoms: About a week ago, Prevx began detecting normal .exe programs such as Nero as infected. When opening Firefox, Windows Media Player would immediately open and play nothing, later found to be the dreaded DesktopLayer.exe related Worm. Also, intermittently when opening Firefox, a box with a Java label would appear and then freeze and crash Firefox. Repeated scans with Prevx would identify a few infections which I would select to be removed, but then they would return at the reboot. I used Malwarebytes' Anti Malware which found about a dozen Trojans and Rootkits on each scan. I would again remove them but then they would return at reboot.Prevx was becoming more erratic through the last few days and detecting my router, Nero, Firefox, and other common .exe's as infected. I noticed that the Task Manager would have IExplorer.exe running on its own, and I haven't used IE in years.My research put me on the correct trail. I implemented ComboFix which did not repair anything, it had no effect. Through further research, I installed Microsoft Security Essentials (MSSE). This program was the only one of the 3 to identify instantly the Win32/Ramnit A and B. It found infections of these type... Read more

A:Win32/Ramnit.A and Win32/Ramnit.B running rampant

Hello, and to the Malware Removal forum! My online alias is Blade Zephon, or Blade for short, and I will be assisting you with your malware issues!If you have since resolved the original problem you were having, we would appreciate you letting us know.In the upper right hand corner of the topic you will see a button called Options. If you click on this in the drop-down menu you can choose Track this topic. By doing this and then choosing Immediate E-Mail notification and then clicking on Proceed you will be advised when we respond to your topic and facilitate the cleaning of your machine.Before we begin cleaning your machine, I'd like to lay out some guidelines for us to follow while we are working together.I will be assisting you with your malware issues. This may or may not resolve other problems you are having with your computer. If you are still having problems after your machine has been determined clean, I will be glad to direct you to the proper forum for assistance.Even if things appear better, that does not mean we are finished. Please continue to follow my instructions until I give you the all clean. Absence of symptoms does not mean that all the malware has been removed. If a piece of the infection is left, it can regenerate and reinfect your machine. Attention to detail is important! Since I cannot see or directly interact with your computer I am dependent on you to "be my eyes" and provide as much information as you can regarding the current state of your ... Read more

Read other 2 answers

I believe that I have been infected by the following Virus: Rootkit.Agent/Gen-DNSHack; WIN32.Downloader.Small.afwj; Win32.Trojan.Dropper.VB.TR. They were all removed by either Zone Alarm Anti-Spyware and SuperAntiSpyware. However, I continue to have the symptoms: sporadic hijack of my keyboard so keystrokes are exected in what appears to be a random fashion. I say it's random because most of the time what's typed by the virus doesn't make any sese.I was working with FAX in the ZoneAlarm user forum who recomended the malware removal tools and suggested I post my Hijackthis log if all else failed. All else has failed. Following is the log. Thanks for your help.
 hijackthis.log   16.26KB
  17 downloadsLogfile of Trend Micro HijackThis v2.0.2Scan saved at 1:13:46 PM, on 6/28/2009Platform: Windows Vista SP2 (WinNT 6.00.1906)MSIE: Internet Explorer v8.00 (8.00.6001.18702)Boot mode: NormalRunning processes:C:\Program Files (x86)\Siber Systems\AI RoboForm\robotaskbaricon.exeC:\Program Files (x86)\WinZip\WZQKPICK.EXEC:\Program Files (x86)\WordWeb\wweb32.exeC:\Program Files (x86)\Hewlett-Packard\Media\DVD\DVDAgent.exeC:\Program Files (x86)\Hewlett-Packard\TouchSmart\Media\TSMAgent.exeC:\Program Files (x86)\Hewlett-Packard\TouchSmart\Media\Kernel\CLML\CLMLSvc.exeC:\Program Files (x86)\HPQ\HP Connection Manager 2�... Read more

A:Infection by Rootkit.Agent/Gen-DNSHack; WIN32.Downloader.Small.afwj; Win32.Trojan.Dropper.VB.TR

Hello and welcome to Bleeping ComputerWe apologize for the delay in responding to your request for help. Here at Bleeping Computer we get overwhelmed at times, and we are trying our best to keep up. Please note that your topic was not intentionally overlooked. Our mission is to help everyone in need, but sometimes it takes just a little longer to get to every request for help. No one is ignored here.If you have since resolved the original problem you were having, we would appreciate you letting us know. If not please perform the following steps below so we can have a look at the current condition of your machine. If you have not done so, include a clear description of the problems you're having, along with any steps you may have performed so far.Upon completing the steps below another staff member will review and take the steps necessary with you to get your machine back in working order clean and free of malware.If you have already posted a DDS log, please do so again, as your situation may have changed.Use the 'Add Reply' and add the new log to this thread.Thanks and again sorry for the delay.We need to see some information about what is happening in your machine. Please perform the following scan:We need to create an OTL ReportPlease download OTL from one of the following mirrors:This is THE MirrorSave it to your desktop.Double click on the icon on your desktop.Click the "Scan All Users" checkbox.Push the button.Two reports will open, copy and paste them in a... Read more

Read other 26 answers

I use ESET NOD32. At startup it detects the win32/Kryptik in a start-up scan and later mentions the Win32 rootkit running in memory. The scan log shows that it has detected this on each startup but it cannot delete because files are locked from removal. I have not been able to tell what file NOD is trying to find. Below is last log file post: This same message is repeated in numerous 10+ restarts in the past 24 hours.

5/19/2009 8:25:51 PM Startup scanner file \\?\globalroot\systemroot\system32\gxvxctxujtymqsiltimrpcilnqyirvmqgrlhk.dll a variant of Win32/Kryptik.PF trojan cleaned by deleting (after the next restart) - quarantined
5/19/2009 8:25:46 PM Startup scanner operating memory Operating memory Win32/Rootkit.Agent.ODG trojan unable to clean

I have run ESET in safe mode. It didnot do anything to eliminate the problem. Windows Defender has apparently not done anything either. Finally, I tried windows malicious software removal, but apparently it could not do anything either.

Main problem I notice is delays in internet usage. Happens both in firefox and ie. I changed DNS settings from automatically detect to a fixed DNS setting from earthlink.net. Still same slow down in internet usage.

Appreciate any help you can give. I have tried to find bad file, but to no avail.


DDS (Ver_09-05-14.01) - NTFSx86
Run by Pop at 21:38:42.70 on Tue 05/19/2009
Internet Explorer: 7.0.... Read more

A:Infected with Win32/Krptik.PF and win32/Rootkit.agent.odg.trojan

It now looks like I may have been able to repair my problem. I used a somewhat, haphazard, unguided approach to removal. The final solution came from AVG Rootkit removal ( http://download.cnet.com/AVG-Anti-Rootkit-...4-10662685.html ). Here is a list of all the steps I attempted. I was worried at times I could have hurt my system, but then I would have had to reinstall the OS. But, on the other hand, some internet posts I read were saying that was the only way to repair the situation. So, desperation took hold. I found my reinstall disks, just in case I needed them and proceeded. ATF Cleaner -- Who needs temp files anyway, especially if they might have trojans, I eliminated temp files this program would find.CC Cleaner - used this to clean out internet cache and history.Recycler folders - I had multiple recycler folders, one that had a rundll in it. I assumed you only have one recycle bin so you only need one of these folders. I had to reset the folder view options in exlorer to see all files and folders (hidden, system, etc.) I deleted the extra recycler folders I could find.System Restore - I turned off system restore. This would erase all the previous positions I had saved. This meant I could never go back to a prior position where my computer was running good, but I didn't know how to find out if I had virus/trojan in one of these saved files I then immediately turned back on the system restore after the old restore files were deleted.b]Windows defender[... Read more

Read other 2 answers

OK- I am not extremely computer savvy... I may have destroyed the computer beyond repair, but my files are not backed up and all of the videos of my son when he was a baby are on there and only there. So, HELP!!!! I had a bad virus that started as pop ups for fake virus protection- I can't even remember what it said. I gave it to my brother in law to fix and it took him a month to tell me I needed to backup my files cause he was going to dump the whole thing. Last night after plugging in the USB and having it fill up without even getting through a 1/4 of our pictures, I decided to try to get rid of the virus myself. I ran malwarebytes which found some items and told me to shut down to complete. I did, got the blue screen- started in safe mode w/ networking (got a pop up that said malwarebytes could not be located). After some more searching, I downloaded Hitman that was made for the DNS virus- I know whatever it is on my computer is really bad. The local connection icon was completely removed. Ethernet driver gone and microsoft system tools like firewall and security all gone. Here is a what hitman said before it told me to reboot to complete the deletion of the virus (s). Rootkit rootkit.mbr.pihar.d (boot image) ,trojan.tdlphaze.1, rootkit.win32.pihar!Ik, Win32/bootkit, Malware gen:variant.graftor.13001 (engine A), backdoor.maxplus, trojan-dropper.win32.sirefeflIK... and 57 items in tempfiles..... HELP PLEASE!

A:. Rootkit rootkit.mbr.pihar.d (boot image) ,trojan.tdlphaze.1, rootkit.win32.pihar!Ik, Win32/bootkit, Malware gen:variant.g...

Copy this tool to the infected PC FSS Checkmark all the boxesClick on "Scan".Please copy and paste the log to your reply.

Read other 1 answers

Hi, here is my problem. Everytime I download some movies or other things by opening my computer overnight, it must pop out a error window said:-C:\Documents and setting\KkianN\Desktop is not accessible.Not enough quota is available to process this command.The icons only left on my screen were My computer,my network places and Internet explorer. When I refresh my computer, it came out the same message again.(this problem was occured when I opened my computer overnight by using Thunder5 this software to download things)When I tried to shut down, a message said You do not have permission to shut down this computer.When I tried to use windows task manager to shut down,once i click Ctrl+Alt+Del, an application error message came out said:-This application failed to initialize properly(0xc000012d). Click on OK to terminate the application.Then I just can reset my computer.Actually I have posted in BleepingComputer.com > Security > Am I infected? What do I do? there.Then I followed the instruction in "Preparation Guide For Use Before Posting A Hijackthis Log". Unfortunately,i can't finish all the steps there. For step 4, I can't remove win32.generic.pws,win32.trojan.psw.delf and Win32.trojan.pws.onlinegames by using Ad-aware 2007. While scanning by using spybot,it stuck while scanning.After that suddenly pop out a window said:-Spybot-Search and destroy has detected an important registry entry that has been changed. Category: System Startup global entr... Read more

A:Infected With Dropper.agent,logger.pcap.a,win32.generic.pws,win32.trojan.psw.delf And Win32.trojan.pws.onlinegames

Hello, I had reformatted my computer since it could not open and stuck in the welcome window few days ago. So, now my computer is alright..thanks for viewing and trying to help me to fix the problem.

Read other 1 answers

m ades, windows xp sp3
to whomever can help- i tried to remove some viruses
using info from bleeping, but am not having any luck.

i downloaded a file that i thought could help me on another
matter, but it had a virus that zone alarm's active scan did not

it was a rootkit virus. i tried tdsskiller several times as well as
malwarebytes, and thought i finally got rid of it. then another
virus popped up despite my not having connected to the internet.

another was this patch virus that kept redirecting my opera
browser. malwarebytes did not see this, but zone alarm did.
i tried to get rid of it and used tdsskiller, and thought i did.
i had to keep switching between safe mode and
normal mode to do it. i had no problems for two weeks, then
both seemed to pop up again. my guess is that i never
actually got rid of them. i tried zone alarm, malwarebytes,
and tdsskiller over and over again, with no luck. then my
ability to connect to the net went away. i gave up and restored
my hdd using the file i made just after i thought i had gotten
rid of the problems, so that though i would still have the viruses,
i would get back the net. using tdsskiller and malwarebytes
still did not work, and a new virus showed up. .

i'm including the logs from zone alarm, malwarebytes, and tdsskiller.

i would really appreciate help.

first to show up. used tdsskiller, seemed to be removed, kept showing back up.

(Forged): C:\WINDOWS\system32... Read more

A:infected with Rootkit.Win32.ZAccess.e, HiddenFile.Multi.Generic, Trojan.Win32.Patched.mf,, Backdoor.Agent.Gen) -> Value: Sh...

ps i have mbam, zone alarm,tdss,
and hijack logs, but was not sure
how to post them since the number
of text characters on this page
was limited.

Read other 70 answers

After start the laptop, (hidden) host.exe is consuming a lot of resources until crash. I can see and kill it with procesexplorer from Sysinternals.
I can't activate Windows Firewall, Malwarebytes show an error at coomputer start up and more...

When I start GMER it shows an error, it is attached.

Here the logs of DDS and GMER:
DDS (Ver_2011-08-26.01) - NTFSx86
Internet Explorer: 8.0.7601.17514 BrowserJavaVersion: 1.6.0_23
Run by sebastian at 16:41:18 on 2012-03-19
Microsoft Windows 7 Enterprise 6.1.7601.1.1252.54.1033.18.2925.1107 [GMT -3:00]
SP: Windows Defender *Disabled/Updated* {D68DDC3A-831F-4fae-9E44-DA132C1ACF46}
============== Running Processes ===============
C:\Windows\system32\svchost.exe -k DcomLaunch
C:\Windows\system32\svchost.exe -k RPCSS
C:\Windows\System32\svchost.exe -k LocalServiceNetworkRestricted
C:\Windows\System32\svchost.exe -k LocalSystemNetworkRestricted
C:\Windows\system32\svchost.exe -k netsvcs
C:\Windows\system32\svchost.exe -k LocalService
C:\Program Files\NVIDIA Corporation\Display\NvXDSync.exe
C:\Windows\system32\svchost.exe -k NetworkService
C:\Program Files\ASUS\ATK Package\ATK Hotkey\ASLDRSrv.ex... Read more

A:trojan-Dropper.win32.injector.ciwr | trojan.win32.agent2.faav | Virus.Win32.ZAccess.q

Hello sebamobile, Welcome to Bleeping Computer.
My name is fireman4it and I will be helping you with your Malware problem.

Please take note of some guidelines for this fix:
Refrain from making any changes to your computer including installing/uninstall programs, deleting files, modifying the registry, and running scanners or tools.
If you do not understand any step(s) provided, please do not hesitate to ask before continuing.
Even if things appear to be better, it might not mean we are finished. Please continue to follow my instructions and reply back until I give you the "all clean".
In the upper right hand corner of the topic you will see a button called Watch Topic.I suggest you click it and select Immediate E-Mail notification and click on Proceed. This way you will be advised when we respond to your topic and facilitate the cleaning of your machine.

Finally, please reply using the ADD REPLY button in the lower right hand corner of your screen. Do not start a new topic. The logs that you post should be pasted directly into the reply, unless they do not fit into the post.
I will be analyzing your log. I will get back to you with instructions.

Read other 14 answers

hi , kaspersky scan(included at the end ) came up with a few infections, please help me with removal logs:Logfile of random's system information tool 1.04 (written by random/random)Run by Yanai Michael at 2008-12-14 13:16:05Microsoft Windows XP Home Edition Service Pack 3System drive C: has 4 GB (9%) free of 53 GBTotal RAM: 1526 MB (53% free)Logfile of Trend Micro HijackThis v2.0.2Scan saved at 13:16:16, on 14/12/2008Platform: Windows XP SP3 (WinNT 5.01.2600)MSIE: Internet Explorer v7.00 (7.00.6000.16762)Boot mode: NormalRunning processes:C:\WINDOWS\System32\smss.exeC:\WINDOWS\system32\winlogon.exeC:\WINDOWS\system32\services.exeC:\WINDOWS\system32\lsass.exeC:\WINDOWS\System32\ibmpmsvc.exeC:\WINDOWS\system32\svchost.exeC:\WINDOWS\System32\svchost.exeC:\Program Files\Intel\Wireless\Bin\EvtEng.exeC:\Program Files\Intel\Wireless\Bin\S24EvMon.exeC:\WINDOWS\system32\spoolsv.exeC:\Program Files\Bonjour\mDNSResponder.exeC:\Program Files\CheckPoint\SSL Network Extender\slimsvc.exeC:\Program Files\Google\Common\Google Updater\GoogleUpdaterService.exeC:\Program Files\IBM\IBM Rapid Restore Ultra\rrpcsb.exeC:\Program Files\Common Files\Microsoft Shared\VS7Debug\mdm.exeC:\Program Files\Microsoft LifeCam\... Read more

A:got Trojan.Win32.Agent.asvc Trojan-GameThief.Win32.Magania.amrr Worm.Win32.AutoRun.trh

Welcome to the BleepingComputer Forums. Since it has been a few days since you scanned your computer with HijackThis, we will need a new HijackThis log. If you have not already downloaded Random's System Information Tool (RSIT), please download Random's System Information Tool (RSIT) by random/random which includes a HijackThis log and save it to your desktop. If you have RSIT already on your computer, please run it again. Double click on RSIT.exe to run RSIT. Click Continue at the disclaimer screen. After it has finished, two logs will open. Please post the contents of both. log.txt will be maximized and info.txt will be minimized. Thank you for your patience.Please see Preparation Guide for use before posting about your potential Malware problem. Thank you for your patience.If you have already posted this log at another forum or if you decide to seek help at another forum, please let us know. There is a shortage of helpers and taking the time of two volunteer helpers means that someone else may not be helped. While we are working on your HijackThis log, please: Reply to this thread; do not start another! Do not make any changes on your computer during the cleaning process or download/add programs on your computer unless instructed to do so. Do not run any other tool until instructed to do so! Let me know if any of the links do not work or if any of the tools do not work. Tell me about problems or symptoms that occur during the fix. Do... Read more

Read other 7 answers


Thank you in advance for your assistance and volunteering your time to this forum. I received some nasty malware when I inserted a client’s flash drive into my PC. Avast popped up immediately and identified Win32: Trojan-gen. However, as soon as this occurred, my PC has been almost unusable and Avast regularly says that my machine is under attack by Win32:Rootkit-gen and Win32: Trojan-gen. Windows runs very slowly, I cannot shut down my computer without a hard reboot, I can open Firefox and use the internet, but as soon as I close the browser, windows locks up (times out forever and nothing responds) and I have to hard reboot. If you could offer any assistance it would be greatly appreciated as my machine is next to useless at the moment!

Below is my Hijackthis log:

Logfile of Trend Micro HijackThis v2.0.2
Scan saved at 8:28:05 AM, on 1/9/2009
Platform: Windows XP SP3 (WinNT 5.01.2600)
MSIE: Internet Explorer v7.00 (7.00.6000.16705)
Boot mode: Normal

Running processes:
C:\Program Files\WIDCOMM\Bluetooth Software\bin\btwdins.exe
C:\Program Files\Alwil Software\Avast4\aswUpdSv.exe
C:\Program Files\Alwil Software\Avast4\ashServ.exe
C:\Program Files\Intel\AMT\atchksrv.exe
C:\Program Files\LANDesk\Shared Files\residentagent.exe
C:\Program Files\LAND... Read more

A:Need Assistance Removing Win32:Rootkit-gen and Win32: Trojan-gen - Thank You!

Bump. Thank you!

Read other 2 answers

Hi,I'm running Windows XP - Internet Explorer v. 6.00, SP3. Yesterday Avast alerted me to a virus on my computer (I neglected to write down the exact message). At the time, only Gmail was open and an email was being written. I've had some issues with Avast occasionally reporting a false positive, and since nothing was being downloaded at that time, I took no action with Avast. Instead, I immediately did a Quick Scan with MalwareBytes to see if it would find anything. MalwareBytes found and deleted the following: C:\Documents and Settings\HP_Owner\application data\Sun\Java\deployment\cache\\6.0\44\61b86cac-3c0c0928Trojan.FakeAlert.VGenC:\Documents and Settings\HP_Owner\local settings\temp\0.506697477033.exeTrojan.FakeAlert.VGenA second MalwareBytes scan was clean.I looked "Trojan.FakeAlert.VGen" up on Google and then it clicked: for the past few days, Adobe Flash Player has been crashing an awful lot. When it crashes (on Youtube, for example), it tells me the program is out of date and needs to be updated. The weird thing was that sometimes it worked for a while before it crashed, but I dismissed that as being some strange computer quirk. I went to the Adobe web site and tried to install the newest version of Flash Player, but was unable to. I feel foolish, but it never even occurred to me that a virus could be to blame. It concerns me that (assuming the Adobe Flash Pla... Read more

A:Trojan.FakeAlert.VGen, SpyInstall_HPPre.exe, Win32: Mirc-z [PUP], Win32: Kill App-W [PUP] & Win32: Agent-AMXO (Trj)

Download Security Check from HERE, and save it to your Desktop. * Double-click SecurityCheck.exe * Follow the onscreen instructions inside of the black box. * A Notepad document should open automatically called checkup.txt; please post the contents of that document.=============================================================================Please download MiniToolBox and run it.Checkmark following boxes:Report IE Proxy SettingsReport FF Proxy SettingsList content of HostsList IP configurationList last 10 Event Viewer logList Users, Partitions and Memory sizeClick Go and post the result.=============================================================================Download Malwarebytes' Anti-Malware (aka MBAM): http://www.malwarebytes.org/products/malwarebytes_free to your desktop. * Double-click mbam-setup.exe and follow the prompts to install the program. * At the end, be sure a checkmark is placed next to Update Malwarebytes' Anti-Malware and Launch Malwarebytes' Anti-Malware, then click Finish. * If an update is found, it will download and install the latest version. * Once the program has loaded, select Perform quick scan, then click Scan. * When the scan is complete, click OK, then Show Results to view the results. * Be sure that everything is checked, and click Remove Selected. * When completed, a log will open in Notepad. * Post the log back here.Be sure to restart the computer.The log can also be found here:C:\Document... Read more

Read other 13 answers

Firefox and Mostly IE is experiencing redirects when I search through any search engine. Avast is continuously stopping malware in the Windows\Temp folder.

DDS (Ver_09-12-01.01) - NTFSx86
Run by Ricardo at 15:09:36.31 on Sun 12/27/2009
Internet Explorer: 7.0.5730.13 BrowserJavaVersion: 1.6.0_17
Microsoft Windows XP Home Edition 5.1.2600.3.1252.1.1033.18.3071.2184 [GMT -8:00]

AV: avast! antivirus 4.8.1368 [VPS 091227-1] *On-access scanning enabled* (Updated) {7591DB91-41F0-48A3-B128-1A293FD8233D}
FW: McAfee Personal Firewall *enabled* {94894B63-8C7F-4050-BDA4-813CA00DA3E8}

============== Running Processes ===============

C:\WINDOWS\system32\svchost -k DcomLaunch
C:\WINDOWS\System32\svchost.exe -k netsvcs
C:\WINDOWS\system32\svchost.exe -k WudfServiceGroup
C:\Program Files\Alwil Software\Avast4\aswUpdSv.exe
C:\Program Files\Alwil Software\Avast4\ashServ.exe
C:\Program Files\Creative\Shared Files\CTAudSvc.exe
C:\Program Files\Common Files\Acronis\Schedule2\schedul2.exe
C:\Program Files\Common Files\Apple\Mobile Device Support\bin\AppleMobileDeviceService.exe
C:\Program Files\Java\jre6\bin\jqs.exe
C:\... Read more

A:Infected with Win32:Malware-gen, Win32:Rootkit-gen, and Win32:Spyware-gen

Please close this post. I'm reformatting and reinstalling an Acronis Image prior to the infection. Thanks anyway.

Read other 2 answers

Hi,It seems that I have trojan activity on my home pc.I am running Vista and when I log in to my user profile I get a blue desktop with a box saying 'Warning! Spyware detected on your computer! Install an antivirus or spyware remover to clean your computer'I have tried a few malware removal programs, Malwarebytes, CCleaner, Adaware and ran virus scans in an attemp to try and remove it myself without bothering you guys but I just can't shift it, so I'm hoping you may have the time to help?What I have noticed is that I only get these warnings when I am logged into my user profile, not as administrator or as another user on the pc. I also get no warnings when running in safe mode.I run Avast and that brings up a warning soon after the blue desktop comes up that points to infection with C:\Users\Guy\AppsData\Local\Temp\tt991.tmp.vbs. The numbers/letters after the tt (in this case 991) change each time I log in. It also states Malware Name: VBS:Malware-gen, Malware Type: Virus/Worm, VBS verison 080805-0,08/05/08 which I try and delete from the warning box.I then am greeted with a windows script host message box that will say the above file (tt991.tmp.vbs) failed (Access Denied).I also regularly get Windows security alert message boxes come up on the screen saying that Windows Firewall has detected activity of harmfull software with mention of one of many trojans. These have been:Trojan-Clicker.Win32.Tiny.hTrojan-Downloader.Win32.Agent.bqTrojan... Read more

A:Vbs:malware-gen - Trojan-clicker.win32.tiny.h, Trojan-downloader.win32.agent.bq, Trojan-spy.win32.keylogger.aa

Hi,I am hoping you can help me.My computer keeps telling me it is infected with spyware/malware. I get a blue desktop on startup with regular warnings saying the computer is infected with:Trojan-Clicker.Win32.Tiny.hTrojan-Downloader.Win32.Agent.bqTrojan-Spy.Win32.KeyLogger.aaTrojan-Spy.Win32.GreenScreenTrojan-Spy.HTML.Bankfraud.dqStrange thing is that these only show up when I log in to my user account. If I log in as administrator, another user or as any user in safe mode I get no warnings and nothing shows up on scans.The pop up warings direct me to this site: www.antispyware-review.info/?wmid=46638&pwebmid=uWfLn0pimL&a= which is Smartsoft reviews to buy PC Antispy or PC Clean pro.Malwarebytes scan picks up Fake.Dropped.Malware, Malware.Trace, Trojan.FakeAlert and Hijack.Wallpaper and even if I remove these and restart the PC they come back.A spybot scan pointed to 2 entries of VirtumondeI'll attach the latest HJT log, Malwarebytes log and Spybot logs in case you need them. Please help me with this, I cant seem to shift it Logfile of Trend Micro HijackThis v2.0.2Scan saved at 11:54:34 AM, on 8/7/2008Platform: Windows Vista SP1 (WinNT 6.00.1905)MSIE: Internet Explorer v7.00 (7.00.6001.18000)Boot mode: NormalRunning processes:C:\Windows\system32\taskeng.exeC:\Windows\system32\Dwm.exeC:\Windows\Explorer.EXEC:\Program Files\Windows Defender\MSASCui.exeC:\Windows\RtHDVCpl.exeC:\Program Files\Ado... Read more

Read other 5 answers

KASPERSKY ONLINE SCANNER 7 REPORTSaturday, November 29, 2008Operating System: Microsoft Windows XP Professional Service Pack 3 (build 2600)Kaspersky Online Scanner 7 version: database last update: Friday, November 28, 2008 18:35:48Records in database: 1424124Scan settingsScan using the following database extendedScan archives yesScan mail databases yesScan area My ComputerC:\D:\E:\F:\Scan statisticsFiles scanned 94300Threat name 4Infected objects 4Suspicious objects 0Duration of the scan 02:45:29File name Threat name Threats countC:\Documents and Settings\All Users\Application Data\FreeApp.exe Infected: Trojan.Win32.Agent.arng 1 C:\Qoobox\Quarantine\C\Program Files\tinyproxy\tinyproxy.exe.vir Infected: Trojan-Proxy.Win32.Agent.bcw 1 C:\RECYCLER\S-1-5-21-1482476501-1644491937-682003330-1013\winse32.exe Infected: IRC-Worm.Win32.Small.x 1 C:\WINDOWS\bolivar24.exe Infected: Backdoor.Win32.Agent.ubx 1 The selected area was scanned.----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Logfile of random's system information tool 1.04 (written by random/random... Read more

A:Infected: Trojan.Win32.Agent.arng, Trojan-Proxy.Win32.Agent.bcw, IRC-Worm.Win32.Small.x, Backdoor.Win32.Agent.ubx

Hello and to Bleeping ComputerWe apologize for the delay in responding to your request for help. Here at Bleeping Computer we get overwhelmed at times, and we are trying our best to keep up. Please note that your topic was not intentionally overlooked. Our mission is to help everyone in need, but sometimes it takes just a little longer to get to every request for help.If you have since resolved the original problem you were having, we would appreciate you letting us know. If not please perform the following steps below so we can have a look at the current condition of your machine. If you have not done so, include a description of your problem, along with any steps you may have performed so far.Upon completing the steps below a staff member will review and take the steps necessary with you to get your machine back in working order clean and free of malware.Thanks and again sorry for the delay.We need to see some information about what is happening in your machine. Please perform the following scan:Download DDS by sUBs from one of the following links. Save it to your desktop.DDS.comDDS.scrDDS.pifDouble click on the DDS icon, allow it to run.A small box will open, with an explaination about the tool. No input is needed, the scan is running.Notepad will open with the results, click no to the Optional_ScanFollow the instructions that pop up for posting the results.Close the program window, and delete the program from your desktop.Please note: You may have to disable any scr... Read more

Read other 4 answers

So, this is a newer netbook, almost 8 months old, i dont know how i got these because i have had anti-virus runing from day one

Anyway it all started when i was on facebook it just went to a diffrent page and i never clicked on anything, then MS security center popped up saying everything was infected, and kept tellin me that i didnt have an antivirus program and i coudlnt do anthing thing but keep going to this ADD to buy one... Which was odd because Avast was running. I opend avast and did a quick check and found the first one Dracur_c, But when i tied to do the the action to mvoe to chest it was telling me that there was not enough room on disc... and my disc is NOT FULL ODD, so i deleted it and it worked i can not coppy and paste the results if i can i dont know how But i will tell you it was in: C:/system volume information/_restore{ number letters}.dll and .EXE and it was also in C:/windows/system32/fwcfg32.dll listed TWICE

I then restarted the computer in safemode and did a full scan and it then found it again in system volume information/restore{letter numbers}.DLL twice And then in Windows/system32/75.tmp..

this morning it was still acting wierd when i started EI redirecting me when i would use google and When i would send an error log to MS the page never loded and then i would get a poppup add So i ran another Avast scan and GOT the win32:trojan-gen,win32:alureon-hd, win32crypt-gwl that came up... This time it was found in my TEMP folder as an EXE and one in my ... Read more

A:avast found win32:dracur_c, win32:trojan-gen,win32:alureon-hd, win32crypt-gwl

Read other 14 answers

My computer has been infected with Win32/Rootkit.Agent.ODG trojan and Win32/Olmarik.JU trojan. AVG, ESET NOD32, and Avira couldn't delete it, and I want to delete it. It redirected all Google searches and slows down my computer. Can you please help me. Thanks ahead to anyone who can help.Here is the HJT logfile:Logfile of Trend Micro HijackThis v2.0.2Scan saved at 2:28:51 PM, on 18/08/2009Platform: Windows XP SP3 (WinNT 5.01.2600)MSIE: Internet Explorer v8.00 (8.00.6001.18702)Boot mode: NormalRunning processes:C:\WINDOWS\System32\smss.exeC:\WINDOWS\system32\winlogon.exeC:\WINDOWS\system32\services.exeC:\WINDOWS\system32\lsass.exeC:\WINDOWS\system32\Ati2evxx.exeC:\WINDOWS\system32\svchost.exeC:\Program Files\Windows Defender\MsMpEng.exeC:\WINDOWS\System32\svchost.exeC:\WINDOWS\system32\svchost.exeC:\WINDOWS\system32\ZoneLabs\vsmon.exeC:\Program Files\CheckPoint\ZAForceField\IswSvc.exeC:\WINDOWS\system32\LEXBCES.EXEC:\WINDOWS\system32\spoolsv.exeC:\WINDOWS\system32\LEXPPS.EXEC:\WINDOWS\Explorer.EXEC:\Program Files\Avira\AntiVir Desktop\sched.exeC:\Program Files\Avira\AntiVir Desktop\avguard.exeC:\Program Files\Common Files\Apple\Mobile Device Support\bin\AppleMobileDeviceService.exeC... Read more

A:Infected with Win32/Rootkit.Agent.ODG trojan and Win32/Olmarik.JU trojan

Hello and to Bleeping ComputerWe apologize for the delay in responding to your request for help. Here at Bleeping Computer we get overwhelmed at times, and we are trying our best to keep up. Please note that your topic was not intentionally overlooked. Our mission is to help everyone in need, but sometimes it takes just a little longer to get to every request for help. No one is ignored here.If you have since resolved the original problem you were having, we would appreciate you letting us know. If not please perform the following steps below so we can have a look at the current condition of your machine. If you have not done so, include a clear description of the problems you're having, along with any steps you may have performed so far.Upon completing the steps below another staff member will review and take the steps necessary with you to get your machine back in working order clean and free of malware.If you have already posted a DDS log, please do so again, as your situation may have changed.Use the 'Add Reply' and add the new log to this thread.Thanks and again sorry for the delay.-----------------------------------------------------------We need to see some information about what is happening in your machine. Please perform the following scan:Download DDS by sUBs from one of the following links. Save it to your desktop.DDS.scrDDS.pifDouble click on the DDS icon, allow it to run.A small box will open, with an explaination about the tool. No input is needed, ... Read more

Read other 20 answers

i am sorry to post a log over here, as i have read through the forum and try to resolve the problem on my own but i failed.since i had ran the comboFix, so i feel that it may be of help to post it.sorry for the trouble..here's the log file...ComboFix 09-07-28.06 - Bentley 07/30/2009 0:35.1.8 - NTFSx86Microsoft? Windows Vista? Ultimate 6.0.6001.1.1252.1.1033.18.3069.1872 [GMT 8:00]Running from: c:\users\Bentley\Desktop\ComboFix.exeSP: SUPERAntiSpyware *disabled* (Updated) {222A897C-5018-402e-943F-7E7AC8560DA7}SP: Windows Defender *enabled* (Updated) {D68DDC3A-831F-4FAE-9E44-DA132C1ACF46} * Created a new restore point.((((((((((((((((((((((((((((((((((((((( Other Deletions ))))))))))))))))))))))))))))))))))))))))))))))))).c:\windows\Install.txtc:\windows\system32\tmp0_144047822718.bkc:\windows\system32\tmp0_16962678345.bkc:\windows\system32\tmp0_205418834021.bkc:\windows\system32\tmp0_355351885288.bkc:\windows\system32\tmp0_424346226483.bkc:\windows\system32\tmp0_516880812123.bkc:\windows\system32\tmp0_517948877969.bkc:\windows\system32\tmp0_525286544717.bkc:\windows\system32\tmp0_687442396617.bkc:\windows\system32\tmp0_77071886817.bkc:\windows\system32\tmp0_779592338841.bkc:\windows\system32\tmp0_790261416358.bkc:\windows\system32\tmp2_1075327197... Read more

A:Infected with win32/rootkit.agent.ODG trojan and win32/Olmarik.JU trojan

Hello and welcome to Bleeping ComputerWe apologize for the delay in responding to your request for help. Here at Bleeping Computer we get overwhelmed at times, and we are trying our best to keep up. Please note that your topic was not intentionally overlooked. Our mission is to help everyone in need, but sometimes it takes just a little longer to get to every request for help. No one is ignored here.If you have since resolved the original problem you were having, we would appreciate you letting us know. If not please perform the following steps below so we can have a look at the current condition of your machine. If you have not done so, include a clear description of the problems you're having, along with any steps you may have performed so far.Upon completing the steps below another staff member will review and take the steps necessary with you to get your machine back in working order clean and free of malware.If you have already posted a DDS log, please do so again, as your situation may have changed.Use the 'Add Reply' and add the new log to this thread.Thanks and again sorry for the delay.We need to see some information about what is happening in your machine. Please perform the following scan:Download DDS by sUBs from one of the following links. Save it to your desktop.DDS.scrDDS.pifDouble click on the DDS icon, allow it to run.A small box will open, with an explaination about the tool. No input is needed, the scan is running.Notepad will open with the results.Foll... Read more

Read other 2 answers

I first noticed the Ramnit virus around the 21st of August when Eset picked it up but it seems to get everywhere. I've never used Combofix before and don't know much about these things. I have added some latest logs for Eset here:06/09/2010 10:03:23 Real-time file system protection file C:\Documents and Settings\N\My Documents\0000200_audacityforaudio_1.htm Win32/Ramnit.A virus deleted - quarantined DDJQMY2J\N Event occurred during an attempt to access the file by the application: C:\WINDOWS\explorer.exe.05/09/2010 18:36:30 Real-time file system protection file C:\Program Files\Tiscali\Tiscali Internet\localpages\offline_page.en-GB.html Win32/Ramnit.A virus deleted - quarantined DDJQMY2J\N Event occurred during an attempt to access the file by the application: C:\WINDOWS\system32\msiexec.exe.05/09/2010 18:35:25 Real-time file system protection file C:\Program Files\Corel\Corel Paint Shop Pro Photo XI\PCUUI\MsgCenter.htm Win32/Ramnit.A virus deleted - quarantined DDJQMY2J\N Event occurred during an attempt to access the file by the application: C:\WINDOWS\system32\msiexec.exe.05/09/2010 18:35:08 Real-time file system protection file C:\Program Files\Corel\Corel Paint Shop Pro Photo XI\PCUUI\Prereg.htm Win32/Ramnit.A virus deleted - quarantined DDJQMY2J\N Event occurred during an attempt to access the file by the appl... Read more

A:Win32/Ramnit.A virus and Win32/Obfuscated

I did a new scan with ESET and it found over 8500 infiltrations of the ramnit virus. I decided to do a factory reset because of this so don't need any help now guys. Keep up the good work here though.

Read other 2 answers


I'm currently battling against what Avast is telling me is the above infection. This computer was originally running AVG and that was picking up the heur trojan, but I changed the anti-virus 'cause AVG sucks and now Ramnit keeps popping up. There's an AVG process that keeps restarting despite uninstalling it. I've run Spybot and am currently performing a full scan with Malwarebytes, which I think is what's making Avast go crazy. As far as I can work out it's infecting things all over the place, but not actually doing anything apart from (so far as I can tell) stopping me opening Firefox, which sends constant crash reports whenever I tell it to start a new session. Avast is 4% into a scan and has found 36 infected files, so I figure this thing is bigger than I can deal with. Help would be much appreciated =) Just finished writing this to have another one pop up for VBS:ExeDropper-gen [Trj]. Balls.

HjT log reads as follows:

Logfile of Trend Micro HijackThis v2.0.4
Scan saved at 15:23:11, on 27/10/2010
Platform: Windows XP SP3 (WinNT 5.01.2600)
MSIE: Internet Explorer v7.00 (7.00.6000.17091)
Boot mode: Normal
Running processes:
C:\Program Files\Alwil Software\Avast5\AvastSvc.exe
C:\WINDO... Read more

A:win32/heur & Win32:Ramnit-E trojans

Hello and Welcome to TSF.

We no longer use HijackThis as our initial analysis tool.

We want all our members to perform the steps outlined in the link I'll give you below, before posting for assistance. There's a sticky at the top of this forum, and a

Having problems with spyware and pop-ups? First Steps

link at the top of each page.


Please follow our pre-posting process outlined here:


After running through all the steps, you shall have a proper set of logs. Please post them in a new topic, as this one shall be closed.

If you have trouble with one of the steps, simply move on to the next one, and make note of it in your reply.

Please note that the Virus/Trojan/Spyware Help forum is extremely busy, and it may take a while to receive a reply.

Read other 1 answers

Hello,Please help if you can .I ran free Avast! version 5.0.677 on my Windows XP desktop computer (Pentium 4, 1.5 Ghz CPU, 1 gb ram), and came up with the following virus warnings. Unfortunately the Avast! software internal tools to remove it are grayed out and not functioning. I tried a couple of things to remove viruses from help online and then realized I was in way over my head. I found this forum and am now requesting help.Avast! says I am affected with:JS:Downloader-AT, Win32:Nimda, Win32:Small-GWM, Win32:VB-EIJ, Win32:WinSpy-CK, JS:ScriptSH-inf, and Win32:VirutAttached a screen shot of Avast! with viruses and partial path to them. Computer's Symptoms (not sure if these are all due to old slow processor or malware):Computer is freezing often;When it is in sleep mode it is turning itself on;Seems to be downloading stuff often and slowing down;Monitor is going black forcing reboots often;Couple weeks back I began getting floating ads that pop up when browsing online;I get an error message daily that says AdAware has shut down unexpectedly, do I want to send a report? I have been ignoring this, not knowing if it was important, been several weeks.Ok, I think that is all I can think of to share. Please help if you can. I appreciate it.Thanks,Dancer~~~~~~~~~~DDS (Ver_10-03-17.01) - NTFSx86 Run by ljk at 15:52:28.93 on Mon 09/20/2010Internet Explorer: 6.0.2900.5512 BrowserJavaVersion: 1.6.0_18Microsoft Windows XP Professional 5.1.2600.3.1252.1.1033.18.102... Read more

A:Please Help ~ Infected with JS:Downloader-AT, Win32:Nimda, Win32:Small-GWM, Win32:VB-EIJ, Win32:WinSpy-CK, JS:ScriptSH-inf, and...

Hello, and to the Malware Removal forum! My online alias is Blade Zephon, or Blade for short, and I will be assisting you with your malware issues!In the upper right hand corner of the topic you will see a button called Options. If you click on this in the drop-down menu you can choose Track this topic. By doing this and then choosing Immediate E-Mail notification and then clicking on Proceed you will be advised when we respond to your topic and facilitate the cleaning of your machine.Before we begin cleaning your machine, I'd like to lay out some guidelines for us to follow while we are working together.I will be assisting you with your malware issues. This may or may not resolve other problems you are having with your computer. If you are still having problems after your machine has been determined clean, I will be glad to direct you to the proper forum for assistance.Even if things appear better, that does not mean we are finished. Please continue to follow my instructions until I give you the all clean. Absence of symptoms does not mean that all the malware has been removed. If a piece of the infection is left, it can regenerate and reinfect your machine. Attention to detail is important! Since I cannot see or directly interact with your computer I am dependent on you to "be my eyes" and provide as much information as you can regarding the current state of your computer.I ask that you please refrain from running tools other than those I su... Read more

Read other 42 answers

please help me....idk what to do....i've removed a lot of other things that were on here but my nod32 didnt detect the following infections.....what can i do next to get rid of all this stuff? and i also have a file called fdccffbffbd.dll that keeps showing up...and i cant delete it....thank you..........and happy thanksgiving*KASPERSKY ONLINE SCANNER 7 REPORT*Wednesday, November 26, 2008Operating System: Microsoft Windows XP Home Edition Service Pack 3(build 2600)Kaspersky Online Scanner 7 version: database last update: Wednesday, November 26, 2008 09:59:47Records in database: 1418243*Scan settings*Scan using the following database extendedScan archives yesScan mail databases yes*Scan area* My ComputerA:\C:\D:\*Scan statistics*Files scanned 101537Threat name 5Infected objects 14Suspicious objects 0Duration of the scan 03:13:31*File name* *Threat name* *Threats count*C:\RECYCLER\S-1-5-21-1951078608-3892172462-226310285-2436\service.exeInfected: Trojan.Win32.Inject.klc 1 C:\WINDOWS\E9799D51180EBCF428C0E71E5EC4E.exe Infected:Trojan.Win32.Qhost.kng 1 C:\WINDOWS\system32\217a4f513bda8c39391806b701df2f85.TMP Infected:Worm.Win32.AutoRun.sqi 1 C:\WINDOWS\system32\2efb3b0a17c581a7bec8fd94826f0358.TMP Infected:Worm.Win32.AutoRun.sqi 1 C:\WINDOWS\system32\76690fc87fd1453bc483de47389e1230.TMP Infected:Worm.Win32.AutoRun.sqi 1 C:\WINDOWS\system32\979e69aafdc832e6... Read more

A:Worm.Win32.AutoRun.sqi, Trojan.Win32.Inject.klc, Trojan.Win32.Monder.zfd


Read other 19 answers

I have done all the requirments you have asked for scanning and removing viruses and spyway before writing this topic. Unfortunatley without success.They are the following: BrowserModifier:Win32/Fotomoto, Trojan:Win32/Virtumonde.O and Trojan:Win/Conhook.DI have used the following to try and fix the problems, but yet again without succes: System Mechanic 7, Windows defender, ad-aware se personal, Symantec, Spybot, Windows Live OneCare, Spyware Doctor, Stinger, and AVG.In the end i still have the same problem. Windows Defender and Windows Live OneCare repetedly detect and remove these infections and it comfirms removal. Yet they keep on appearing. In System Mechanic there is i file i found that is running but it says it is dangerous for my system and it forms part of virtumonde, it is the following: geeba.dll but i cannot remove or delete it.Here is the log that i just ran with Trend Micro HijackThis- v2.0.2Logfile of Trend Micro HijackThis v2.0.2Scan saved at 3:07:01 PM, on 9/9/2007Platform: Windows XP SP2 (WinNT 5.01.2600)MSIE: Internet Explorer v7.00 (7.00.6000.16512)Boot mode: NormalRunning processes:C:\WINDOWS\System32\smss.exeC:\WINDOWS\system32\winlogon.exeC:\WINDOWS\system32\services.exeC:\WINDOWS\system32\lsass.exeC:\WINDOWS\system32\svchost.exeC:\Program Files\Microsoft Windows OneCare Live\Antivirus\MsMpEng.exeC:\WINDOWS\System32\svchost.exeC:\WINDOWS�... Read more

A:Trojan:win32/virtumonde.o, Browsermodifier:win32/fotomoto, Trojan:win32/conhook.d

Download the latest version of ComboFix from Here to your Desktop.Double click combofix.exe and follow the prompts.When finished, it shall produce a log for you. Post that log and a HiJackthis log in your next replyNote: Do not mouseclick combofix's window while its running. That may cause it to stall

Read other 4 answers

It started with a backdoor virus which I removed. Next, Windows Defence popped up so I removed it. Then Security Suite popped up so I removed it. Now I have the following:Trojan.Win32/Hiloti.gen!DTrojan.Win32/Tibs.JLTrojanSpy.Win32/UrsnifWhen in normal mode sometimes I can get on the internet and other times I cannot. Last night I got online and it wouldn't let me close the browser. I could navigate to different websites but at the bottom it just kept showing new websites were loading and usernames, none of which actually loaded. I am now in safe mode with networking capabilities. I tried to download Microsoft Securities virus scan prior to coming here and it said I did not have administrative rights to do so; however, I downloaded all the things in your preparation guidelines without a problem.I am a novice computer user at best so please keep that in mind with your instructions. Thanks!DDS.txtDDS (Ver_10-03-17.01) - NTFSx86 NETWORK Run by Alicia at 7:59:22.59 on Mon 09/06/2010Internet Explorer: 8.0.6001.18943Microsoft? Windows Vista? Home Basic 6.0.6002.2.1252.1.1033.18.2037.954 [GMT -7:00]AV: Symantec AntiVirus *On-access scanning enabled* (Updated) {FB06448E-52B8-493A-90F3-E43226D3305C}SP: Symantec AntiVirus *enabled* (Updated) {6C85A515-B91D-4D2B-AF18-40984A4A8493}SP: Windows Defender *enabled* (Updated) {D68DDC3A-831F-4FAE-9E44-DA132C1ACF46}============== Running Processes ===============C:\Windows\system32\wininit.exeC:\Windows\... Read more

A:Trojan.win32/Hiloti.gen!D, Trojan.win32/Tibs.JL, TrojanSpy.win32/Ursnif

Hello and welcome to Bleeping ComputerWe apologize for the delay in responding to your request for help. Here at Bleeping Computer we get overwhelmed at times, and we are trying our best to keep up. Please note that your topic was not intentionally overlooked. Our mission is to help everyone in need, but sometimes it takes just a little longer to get to every request for help. No one is ignored here.If you have since resolved the original problem you were having, we would appreciate you letting us know. If not please perform the following steps below so we can have a look at the current condition of your machine. Please include a clear description of the problems you're having, along with any steps you may have performed so far.Please refrain from running tools or applying updates other than those we suggest while we are cleaning up your computer. The reason for this is so we know what is going on with the machine at any time. Some programs can interfere with others and hamper the recovery process.Even if you have already provided information about your PC, we need a new log to see what has changed since you originally posted your problem.We need to create an OTL ReportPlease download OTL from one of the following mirrors:This is THE MirrorSave it to your desktop.Double click on the icon on your desktop.Click the "Scan All Users" checkbox.In the custom scan box paste the following:CODEmsconfigsafebootminimalactivexdrivers32netsvcs%SYSTEMDRIVE%\*.exe/md5st... Read more

Read other 3 answers

Avast continually blocks the following threats: - Win32:Malware-gen - WIn32:Downloader-PKU [Trj] - Win32:DNSChanger-VJ [Trj]Avast scans and detects Win32:Sirefef-PL [Rtk], cannot remove it though.Malwarebytes scan detects BCminer, quarantines it, though never seems to get rid of BCminer. Other issues of possible note: - Windows Firewall not running 0x80070424 - Backup & Restore - last backup did not complete successfully - server execution failed - 0x80080005Ran both DDS and GMER (GMER did not have all the options available as per the preparation guide, and did not log anything when the scan was complete). .DDS (Ver_2011-08-26.01) - NTFSAMD64 Internet Explorer: 9.0.8112.16421Run by Family-pc at 12:37:05 on 2012-08-05Microsoft Windows 7 Home Premium 6.1.7601.1.1252.2.1033.18.16383.13888 [GMT -4:00].SP: Windows Defender *Disabled/Updated* {D68DDC3A-831F-4fae-9E44-DA132C1ACF46}.============== Running Processes ===============.C:\Windows\system32\wininit.exeC:\Windows\system32\lsm.exeC:\Windows\system32\svchost.exe -k DcomLaunchC:\Windows\system32\svchost.exe -k RPCSSC:\Windows\system32\atiesrxx.exeC:\Windows\System32\svchost.exe -k LocalServiceNetworkRestrictedC:\Windows\System32\svchost.exe -k LocalSystemNetworkRestrictedC:\Windows\system32\svchost.exe -k netsvcsC:\Windows\system32\svchost.exe -k LocalServiceC:\Windows\sy... Read more

A:Win32:Sirefef-PL, Win32:Malware-gen, WIn32:Downloader-PKU [Trj], Win32:DNSChanger-VJ [Trj], BCMiner need help

Hello Njals, Welcome to Bleeping Computer.
My name is fireman4it and I will be helping you with your Malware problem.

Please take note of some guidelines for this fix:
Refrain from making any changes to your computer including installing/uninstall programs, deleting files, modifying the registry, and running scanners or tools.
If you do not understand any step(s) provided, please do not hesitate to ask before continuing.
Even if things appear to be better, it might not mean we are finished. Please continue to follow my instructions and reply back until I give you the "all clean".
In the upper right hand corner of the topic you will see a button called Watch Topic.I suggest you click it and select Immediate E-Mail notification and click on Proceed. This way you will be advised when we respond to your topic and facilitate the cleaning of your machine.

Finally, please reply using the ADD REPLY button in the lower right hand corner of your screen. Do not start a new topic. The logs that you post should be pasted directly into the reply, unless they do not fit into the post.
I will be analyzing your log. I will get back to you with instructions.Do you have a USB Flash Drive you can use?

Read other 21 answers

I believe I was infected last night when a website somehow redirected me to liteautogreatest{dot}cn.I'm running XP Home SP3 and the ZoneAlarm Internet Security Suite (just updated earlier today).ZoneAlarm continually finds a couple of problems and hibernates them but they do not go completely away after a reboot.The ZoneAlarm active monitor scan shows the following...Trojan-Dropper.Win32.Agent.amzh was found in C:\Documents and Settings\Don\Local Settings\Temp\BNB.tmp on 4/20/2009 13:29:22Trojan-Dropper.Win32.Agent.amzh was found in C:\Documents and Settings\Don\Local Settings\Temp\BNA.tmp on 4/20/2009 13:23:26Trojan-Dropper.Win32.Agent.amzh was found in C:\Documents and Settings\Don\Local Settings\Temp\BN9.tmp on 4/20/2009 13:17:40Trojan-Dropper.Win32.Agent.amzh was found in C:\Documents and Settings\Don\Local Settings\Temp\BN8.tmp on 4/20/2009 13:14:30Trojan-Dropper.Win32.Agent.amzh was found in C:\Documents and Settings\Don\Local Settings\Temp\BN7.tmp on 4/20/2009 13:07:26Trojan-Dropper.Win32.Agent.amzh was found in C:\Documents and Settings\Don\Local Settings\Temp\BN6.tmp on 4/20/2009 13:02:40Rootkit.Win32.Agent.ikz was found in C:\WINDOWS\system32\drivers\systemntmi.sys on 4/20/2009 12:57:48Trojan-Dropper.Win32.Agent.amzh was found in C:\Documents and Settings\Don\Local Settings\T... Read more

A:Infected with Rootkit.Win32.Agent.ikz, Trojan-Dropper.Win32.Agent.amzh, Trojans? Malware?

Please download ATF Cleaner by Atribune & save it to your desktop. DO NOT use yet.alternate download linkThen download and install SUPERAntiSpyware FreeDouble-click SUPERAntiSypware.exe and use the default settings for installation.An icon will be created on your desktop. Double-click that icon to launch the program.If it will not start, go to Start > All Prgrams > SUPERAntiSpyware and click on Alternate Start.If asked to update the program definitions, click "Yes". If not, update the definitions before scanning by selecting "Check for Updates". (If you encounter any problems while downloading the updates, manually download them from here. Double-click on the hyperlink for Download Installer and save SASDEFINITIONS.EXE to your desktop. Then double-click on SASDEFINITIONS.EXE to install the definitions.)In the Main Menu, click the Preferences... button.Click the "General and Startup" tab, and under Start-up Options, make sure "Start SUPERAntiSpyware when Windows starts" box is unchecked.Click the "Scanning Control" tab, and under Scanner Options, make sure the following are checked (leave all others unchecked):Close browsers before scanning.Scan for tracking cookies.Terminate memory threats before quarantining.Click the "Close" button to leave the control center screen and exit the program.Do not run a scan just yet.Reboot your computer in "Safe Mode" using the F8 method. To do this, re... Read more

Read other 3 answers

Hello, I am having a serious problem with the above named Virus and Worm. I apologize in advance if I fail to include any pertinent information, haven't dealt with anything like this before.

Machine: 1 year old Dell Inspiron Desktop
OS: Windows XP
Security Software: Prevx, Malwarebytes Anti-Malware, and Microsoft Security Essentials.

Symptoms: About a week ago, Prevx began detecting normal .exe programs such as Nero as infected. When opening Firefox, Windows Media Player would immediately open and play nothing, later found to be the dreaded DesktopLayer.exe related Worm. Also, intermittently when opening Firefox, a box with a Java label would appear and then freeze and crash Firefox. Repeated scans with Prevx would identify a few infections which I would select to be removed, but then they would return at the reboot. I used Malwarebytes' Anti Malware which found about a dozen Trojans and Rootkits on each scan. I would again remove them but then they would return at reboot.

Prevx was becoming more erratic through the last few days and detecting my router, Nero, Firefox, and other common .exe's as infected. I noticed that the Task Manager would have IExplorer.exe running on its own, and I haven't used IE in years.

My research put me on the correct trail. I implemented ComboFix which did not repair anything, it had no effect. Through further research, I installed Microsoft Security Essentials (MSSE). This program was the only one of the 3 to identify ins... Read more

A:Win32/Ramnit.A and Win32/Ramnit.B decimating everything

this sort of infection is best to fix by formatting as its very tough to remove and can cause a PC to become unbootable

if you want to give it a shot let me know and we can try fix it, but I would recommend a format

Read other 1 answers

Hi, as the title suggests I'm asking if I'm free of Win32/Ramnit.A / Win32/Ramnit.B, I'm asking for far less than an actual malware removal, I hope.I understand that it is most likely that the system will never be free from this type of malware but I would like to try anyway. I do also understand that it may be difficult to give a definite answer just based on the information from the logs but any response/help is appreciated.The computer was infected by the worm(s) around the 4th October 2010 and I've been doing pretty much nothing except trying to get rid of it.I've done a Full Scan with ESET Smart Security 4 - Took over 9 and a half hours, scanning over 1.2 million files/objects, which I can provide a log for.I've done a Quick Scan and Full Scan with Dr.Web CureIt! - Took 7 hours.I've done a Quick Scan and Full Scan with Malwarebytes' Anti-Malware - Took over 7, which I can provide a log for.I've done a part of a Quick Scan with avast! - It became stuck at 13%.I've done a Quick Scan with SUPERAntiSpyware - Took over 1 and a half hours.I'll probably do a Full Scan with SUPERAntiSpyware tomorrow, then get to backing up the important personal uninfected files, if there are any.I have not yet ran ComboFix.exe nor VundoFix.exe, I won't do so unless you suggest that I do?ESET pop-ups were appearing in the dozens per seconds detecting the worm spreading to more and more files and at the same time cleaning/deleting them. I ma... Read more

A:Am I Win32/Ramnit.A / Win32/Ramnit.B free?

I'm afraid I have very bad news.Win32/Ramnit.A / Win32/Ramnit.B are file infectors with IRCBot functionality which infects .exe, and .HTML/HTM files, and opens a back door that compromises your computer. Using this backdoor, a remote attacker can access and instruct the infected computer to download and execute more malicious files. The infected .HTML or .HTM files may be detected as The infected .HTML or .HTM files may be detected as Virus:VBS/Ramnit.A or VBS/Generic. Win32/Ramnit.A!dll is a related file infector often seen with this infection. It too has IRCBot functionality which infects .exe, .dll and .HTML/HTM files and opens a back door that compromises your computer. This component is injected into the default web browser by Worm:Win32/Ramnit.A which is dropped by a Ramnit infected executable file. -- Note: As with most malware infections, the threat name may be different depending on the anti-virus or anti-malware program which detected it. Each security vendor uses their own naming conventions to identify various types of malware.Understanding virus namesThreat aliases for W32/Ramnit.a!35B43CB537D0Threat aliases for W32/Ramnit.a!5343A023502CWith this particular infection the safest solution and only sure way to remove it effectively is to reformat and reinstall the OS.Why? The malware injects code in legitimate files similar to the Virut virus and in many cases the infected files (which could number in the thousands) cannot be disinfected prop... Read more

Read other 1 answers

Originally Virus Heat installed itself onto my computer then we added CA Security anti virus and anti spyware protection. This cleaned up some of the problem but I had to download spybot search and destroy to find more spyware. There was a lot of Z lob spyware on the computer. I have spent countless hours on the phone with tech support with Time Warner who is my internet provider who suggested the CA Security that isn't picking up on everything. Now when I run a full scan with CA on my computer it says there are no infections but I keep getting a pop up from CA saying there are 33 infected items. The pop up is random- it isn't in connection with the anti-virus scan. They aren't deleted or quarentened, the pop up just states the file name, infection name, type which is "file" and status which is infected. There are 10 win32/vmalum.ccpy, 19 win32/crushpy!generic, 1 win32/vmalum.ccqd, 2 win32/bewschy.d and 1 vmalum.ccqa. The files aren't quarentened so I can't go in and delete them and when I run the scan to clean them up it isn't picking up on them. So CA anti virus scan isn't picking up on these infected files but then again it is because the pop up knows they are there? Does this make sense? Almost like it knows they are there but it can't do anything with them? Time Warner suggested I get a trojan hunter, is this appropriate? Are you familiar with these infection types? I have googled the names but nothing comes u... Read more

A:Win32/bewschy.d, Win32/vmalum.ccpy, Win32/vmalum.ccqa,win32/crushpy!generic, Win32/vmalum.ccqd

What OS (Win 2K, XPsp1, XPsp2, Vista) are you using? Have you tried doing your scans in "Safe Mode"? Are you doing scans while logged into the "Administrator Account" or an "account with administrator privileges"? You need to start there first. If rescanning in Safe Mode does not help, then do this:Please perform an online scan with Kaspersky WebScannerClick on You will be promted to install an ActiveX component from Kaspersky, Click The program will launch and then begin downloading the latest definition files:Once the files have been downloaded click on Now click on In the scan settings make that the following are selected:Scan using the following Anti-Virus database:Extended (if available otherwise Standard)
Scan Options:Scan Archives
Scan Mail BasesClick Now under select a target to scan:Select My ComputerThis will program will start and scan your system.The scan will take a while so be patient and let it run.Once the scan is complete it will display if your system has been infected.Now click on the Save as Text button:Save the file to your desktop.Copy and paste the scan results in your next reply.

Read other 11 answers